DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ hattendorf-2007-1 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Hattendorf DA., Andreeva A., Gangar A., Brennwald PJ., Weis WI. DIP original experiment: DIP-253284X Nature 2007 IMEx Structure of the yeast polarity protein Sro7 reveals a SNARE regulatory mechanism. Hattendorf DA., Andreeva A., Gangar A., Brennwald PJ., Weis WI. Only protein-protein interactions imex curation hattendorf-2007-2 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Hattendorf DA., Andreeva A., Gangar A., Brennwald PJ., Weis WI. DIP original experiment: DIP-253277X Nature 2007 IMEx Structure of the yeast polarity protein Sro7 reveals a SNARE regulatory mechanism. Hattendorf DA., Andreeva A., Gangar A., Brennwald PJ., Weis WI. Only protein-protein interactions imex curation hattendorf-2007-3 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Hattendorf DA., Andreeva A., Gangar A., Brennwald PJ., Weis WI. DIP original experiment: DIP-253282X Nature 2007 IMEx Structure of the yeast polarity protein Sro7 reveals a SNARE regulatory mechanism. Hattendorf DA., Andreeva A., Gangar A., Brennwald PJ., Weis WI. Only protein-protein interactions imex curation hattendorf-2007-4 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hattendorf DA., Andreeva A., Gangar A., Brennwald PJ., Weis WI. DIP original experiment: DIP-253280X Nature 2007 IMEx Structure of the yeast polarity protein Sro7 reveals a SNARE regulatory mechanism. Hattendorf DA., Andreeva A., Gangar A., Brennwald PJ., Weis WI. Only protein-protein interactions imex curation hattendorf-2007-5 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hattendorf DA., Andreeva A., Gangar A., Brennwald PJ., Weis WI. DIP original experiment: DIP-253281X Nature 2007 IMEx Structure of the yeast polarity protein Sro7 reveals a SNARE regulatory mechanism. Hattendorf DA., Andreeva A., Gangar A., Brennwald PJ., Weis WI. Only protein-protein interactions imex curation hattendorf-2007-6 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Hattendorf DA., Andreeva A., Gangar A., Brennwald PJ., Weis WI. DIP original experiment: DIP-253279X Nature 2007 IMEx Structure of the yeast polarity protein Sro7 reveals a SNARE regulatory mechanism. Hattendorf DA., Andreeva A., Gangar A., Brennwald PJ., Weis WI. Only protein-protein interactions imex curation hattendorf-2007-7 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Hattendorf DA., Andreeva A., Gangar A., Brennwald PJ., Weis WI. DIP original experiment: DIP-253283X Nature 2007 IMEx Structure of the yeast polarity protein Sro7 reveals a SNARE regulatory mechanism. Hattendorf DA., Andreeva A., Gangar A., Brennwald PJ., Weis WI. Only protein-protein interactions imex curation hattendorf-2007-8 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Hattendorf DA., Andreeva A., Gangar A., Brennwald PJ., Weis WI. DIP original experiment: DIP-253278X Nature 2007 IMEx Structure of the yeast polarity protein Sro7 reveals a SNARE regulatory mechanism. Hattendorf DA., Andreeva A., Gangar A., Brennwald PJ., Weis WI. Only protein-protein interactions imex curation sec9_yeast Protein transport protein SEC9 SEC9 HSS7 YGR009C protein protein yeast Saccharomyces cerevisiae Baker's yeast MGLKKFFKIKPPEEATPEQNKDTLMELGISVKNPSKKRKEKFAAYGKFANDKAEDKVYAPPGYEQYARPQDELEDLNASPLDANANEATAGSNRGSSGTQDLGNGAESNSMQDPYAIENDDYRYDDDPYARFQANKSNGRGSVNAAPYGDYGGGYNGTSLNSYNNDGPYSNQNTSNSWVNANGRNSLNHSNSTLNVGPSRQTRQPPVSTSTNSLSLDQRSPLANPMQEKRNPYADMNSYGGAYDSNTNRSSGTRQGSSKNANPYASMANDSYSNGNLNRSANPYSSRSVRQPQSQQAPMTYTPSFIASDEAARNSEVDLNEEPRTGEFDFEEVYADKSAENRAALDEPDLNAVMTNEDSIDLNASEVDHSSRQQQQQQWFMDEQQQQQQHFNATNNQYGDQRGYKTFEEIQKEEEARQQQEEDEAVDEIKQEIKFTKQSSVASTRNTLKMAQDAERAGMNTLGMLGHQSEQLNNVEGNLDLMKVQNKVADEKVAELKKLNRSILAVHVSNPFNSKRRRREREEQLKNRKIEEKLMREQTSQQLSQSTQRIEGAMNANNNISEVRERYQRKNVLEKAKRYQFENDEEDDEMELEIDRNLDQIQQVSNRLKKMALTTGKELDSQQKRLNNIEESTDDLDINLHMNTNRLAGIR EA314D73D20A10C7 sro7_yeast Lethal(2) giant larvae protein homolog SRO7 SRO7 SNI1 YPR032W YP9367.12 SOP1 Suppressor of RHO3 protein 7 Polarity protein SRO7 Sodium protection protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MFGSKRLKNVKEAFKSLKGQNSETPIENSKASFKSKNSKTSTISKDAKSSSSLKIPISSNNKNKIFSLAETNKYGMSSKPIAAAFDFTQNLLAIATVTGEVHIYGQQQVEVVIKLEDRSAIKEMRFVKGIYLVVINAKDTVYVLSLYSQKVLTTVFVPGKITSIDTDASLDWMLIGLQNGSMIVYDIDRDQLSSFKLDNLQKSSFFPAARLSPIVSIQWNPRDIGTVLISYEYVTLTYSLVENEIKQSFIYELPPFAPGGDFSEKTNEKRTPKVIQSLYHPNSLHIITIHEDNSLVFWDANSGHMIMARTVFETEINVPQPDYIRDSSTNAAKISKVYWMCENNPEYTSLLISHKSISRGDNQSLTMIDLGYTPRYSITSYEGMKNYYANPKQMKIFPLPTNVPIVNILPIPRQSPYFAGCHNPGLILLILGNGEIETMLYPSGIFTDKASLFPQNLSWLRPLATTSMAASVPNKLWLGALSAAQNKDYLLKGGVRTKRQKLPAEYGTAFITGHSNGSVRIYDASHGDIQDNASFEVNLSRTLNKAKELAVDKISFAAETLELAVSIETGDVVLFKYEVNQFYSVENRPESGDLEMNFRRFSLNNTNGVLVDVRDRAPTGVRQGFMPSTAVHANKGKTSAINNSNIGFVGIAYAAGSLMLIDRRGPAIIYMENIREISGAQSACVTCIEFVIMEYGDDGYSSILMVCGTDMGEVITYKILPASGGKFDVQLMDITNVTSKGPIHKIDAFSKETKSSCLATIPKMQNLSKGLCIPGIVLITGFDDIRLITLGKSKSTHKGFKYPLAATGLSYISTVEKNNDRKNLTVIITLEINGHLRVFTIPDFKEQMSEHIPFPIAAKYITESSVLRNGDIAIRVSEFQASLFSTVKEQDTLAPVSDTLYINGIRIPYRPQVNSLQWARGTVYCTPAQLNELLGGVNRPASKYKESIIAEGSFSERSSDDNNANHPEHQYTKPTRKGRNSSYGVLRNVSRAVETRWDAVEDRFNDYATAMGETMNEAVEQTGKDVMKGALGF FFB0901883009815 sso1_yeast Protein SSO1 SSO1 P1405 YPL232W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSYNNPYQLETPFEESYELDEGSSAIGAEGHDFVGFMNKISQINRDLDKYDHTINQVDSLHKRLLTEVNEEQASHLRHSLDNFVAQATDLQFKLKNEIKSAQRDGIHDTNKQAQAENSRQRFLKLIQDYRIVDSNYKEENKEQAKRQYMIIQPEATEDEVEAAISDVGGQQIFSQALLNANRRGEAKTALAEVQARHQELLKLEKSMAELTQLFNDMEELVIEQQENVDVIDKNVEDAQLDVEQGVGHTDKAVKSARKARKNKIRCWLIVFAIIVVVVVVVVVPAVVKTR 6E4C6D35C3CD9D94 snc2_yeast Synaptobrevin homolog 2 SNC2 YOR327C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSSVPYDPYVPPEESNSGANPNSQNKTAALRQEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAISAQGFKRGANRVRKQMWWKDLKMRMCLFLVVIILLVVIIVPIVVHFS 815F027FAD8A599B sec9-sro7-1 3154590 N/A 3154598 unspecified role unspecified role unspecified role unspecified role Region 250-372 Region 250-372 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3154599 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false sec9-snc2-1 3154591 N/A 3154600 unspecified role unspecified role prey prey Region 145-265 Region 145-265 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3154601 unspecified role unspecified role prey prey Region 1-92 Region 1-92 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3154598 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3154599 unspecified role unspecified role prey prey Region 61-891 Region 61-891 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false sec9-snc2-2 3154592 N/A 3154600 unspecified role unspecified role prey prey Region 145-265 Region 145-265 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3154601 unspecified role unspecified role prey prey Region 1-92 Region 1-92 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3154598 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 401-661 Region 401-661 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli association association false false false sro7-sec9-1 3154593 N/A 3154598 unspecified role unspecified role prey prey Region 414-651 Region 414-651 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3154599 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false sec9-sro7-2 3154594 N/A 3154598 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3154599 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false sec9-sro7-3 3154595 N/A 3154598 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3154599 unspecified role unspecified role unspecified role unspecified role Region 61-891 Region 61-891 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q12038:p.Tyr700Ala Y700A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q12038:p.Pro721Ala P721A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q12038:p.Glu562Ala E562A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q12038:p.Arg664Ala R664A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q12038:p.Met764Ala M764A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false sec9-sro7-4 3154596 N/A 3154598 unspecified role unspecified role unspecified role unspecified role Region 250-372 Region 250-372 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3154599 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false sec9-sro7-5 3154597 N/A 3154598 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 401-661 Region 401-661 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli N/A 3154599 unspecified role unspecified role prey prey Region 61-891 Region 61-891 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false