DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ peng-2007-9 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Peng T., Zintsmaster JS., Namanja AT., Peng JW. DIP original experiment: DIP-66678X Nature structural & molecular biology 2007 IMEx Sequence-specific dynamics modulate recognition specificity in WW domains. Peng T., Zintsmaster JS., Namanja AT., Peng JW. Only protein-protein interactions imex curation cdc25 Cdc25 [fragment] EQPLTPVTDL protein protein xenla Xenopus laevis (African clawed frog) African clawed frog EQPLTPVTDL pin1_human Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 Rotamase Pin1 Peptidyl-prolyl cis-trans isomerase Pin1 PIN1 protein protein human Homo sapiens Human MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE cdc25-pin1-1 3153395 N/A 3153396 unspecified role unspecified role neutral component neutral component T5 phosphothreonine T5 phosphothreonine opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3153397 unspecified role unspecified role neutral component neutral component 6-39 binding region 6-39 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false