DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ hollenstein-2007-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Hollenstein K., Frei DC., Locher KP. DIP original experiment: DIP-253264X Nature 2007 IMEx Structure of an ABC transporter in complex with its binding protein. Hollenstein K., Frei DC., Locher KP. Only protein-protein interactions imex curation hollenstein-2007-2 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Hollenstein K., Frei DC., Locher KP. DIP original experiment: DIP-253266X Nature 2007 IMEx Structure of an ABC transporter in complex with its binding protein. Hollenstein K., Frei DC., Locher KP. Only protein-protein interactions imex curation hollenstein-2007-3 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Hollenstein K., Frei DC., Locher KP. DIP original experiment: DIP-253267X Nature 2007 IMEx Structure of an ABC transporter in complex with its binding protein. Hollenstein K., Frei DC., Locher KP. Only protein-protein interactions imex curation hollenstein-2007-4 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Hollenstein K., Frei DC., Locher KP. DIP original experiment: DIP-253265X Nature 2007 IMEx Structure of an ABC transporter in complex with its binding protein. Hollenstein K., Frei DC., Locher KP. Only protein-protein interactions imex curation wtpa_arcfu Molybdate/tungstate-binding protein WtpA wtpA modA AF_0094 protein protein arcfu Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) MHIGGGVVKIRILILLMLALFLLGCSSNVNTNVKLKVFHAGSLTEPMKAFKRAFEEKHPNVEVQTEAAGSAATIRKVTELGRKADVIATADYTLIQKMMYPEFANWTIMFAKNQIVLAYRNDSRYADEINSQNWYEILKRPDVRFGFSNPNDDPCGYRSLMAIQLAELYYNDPTIFDELVAKNSNLRFSEDNGSYVLRMPSSERIEINKSKIMIRSMEMELIHLVESGELDYFFIYKSVAKQHGFNFVELPVEIDLSSPDYAELYSKVKVVLANGKEVTGKPIVYGITIPKNAENRELAVEFVKLVISEEGQEILRELGQEPLVPPRADTAVPSLKAMVEVS wtpb_arcfu Molybdate/tungstate transport system permease protein WtpB wtpB modB AF_0093 protein protein arcfu Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) MRLLFSALLALLSSIILLFVLLPVAATVTLQLFNFDEFLKAASDPAVWKVVLTTYYAALISTLIAVIFGTPLAYILARKSFPGKSVVEGIVDLPVVIPHTVAGIALLVVFGSSGLIGSFSPLKFVDALPGIVVAMLFVSVPIYINQAKEGFASVDVRLEHVARTLGSSPLRVFFTVSLPLSVRHIVAGAIMSWARGISEFGAVVVIAYYPMIAPTLIYERYLSEGLSAAMPVAAILILLSLAVFVALRIIVGREDVSEGQG wtpc_arcfu Molybdate/tungstate import ATP-binding protein WtpC wtpC modC AF_0092 protein protein arcfu Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) MFLKVRAEKRLGNFRLNVDFEMGRDYCVLLGPTGAGKSVFLELIAGIVKPDRGEVRLNGADITPLPPERRGIGFVPQDYALFPHLSVYRNIAYGLRNVERVERDRRVREMAEKLGIAHLLDRKPARLSGGERQRVALARALVIQPRLLLLDEPLSAVDLKTKGVLMEELRFVQREFDVPILHVTHDLIEAAMLADEVAVMLNGRIVEKGKLKELFSAKNGEVAEFLSARNLLLKVSKILD wtpa-wtpb-1 3153364 N/A 3153368 unspecified role unspecified role unspecified role unspecified role Region 32-342 Region 32-342 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3153369 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3153370 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false wtpb-wtpc-1 3153365 N/A 3153369 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3153370 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false wtpb-wtpc-2 3153366 N/A 3153369 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3153370 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association false false false wtpa-wtpb-2 3153367 N/A 3153368 unspecified role unspecified role unspecified role unspecified role Region 32-342 Region 32-342 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3153369 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3153370 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false