DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ jeans-2007-1 in vitro In vitro solid phase assay solid phase assay predetermined predetermined participant predetermined Jeans AF., Oliver PL., Johnson R., Capogna M., Vikman J., Molnár Z., Babbs A., Partridge CJ., Salehi A., Bengtsson M., Eliasson L., Rorsman P., Davies KE. DIP original experiment: DIP-261049X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx A dominant mutation in Snap25 causes impaired vesicle trafficking, sensorimotor gating, and ataxia in the blind-drunk mouse. Jeans AF., Oliver PL., Johnson R., Capogna M., Vikman J., Molnár Z., Babbs A., Partridge CJ., Salehi A., Bengtsson M., Eliasson L., Rorsman P., Davies KE. Only protein-protein interactions imex curation jeans-2007-2 in vitro In vitro solid phase assay solid phase assay predetermined predetermined participant predetermined Jeans AF., Oliver PL., Johnson R., Capogna M., Vikman J., Molnár Z., Babbs A., Partridge CJ., Salehi A., Bengtsson M., Eliasson L., Rorsman P., Davies KE. DIP original experiment: DIP-261050X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx A dominant mutation in Snap25 causes impaired vesicle trafficking, sensorimotor gating, and ataxia in the blind-drunk mouse. Jeans AF., Oliver PL., Johnson R., Capogna M., Vikman J., Molnár Z., Babbs A., Partridge CJ., Salehi A., Bengtsson M., Eliasson L., Rorsman P., Davies KE. Only protein-protein interactions imex curation snp25_mouse Synaptosomal-associated protein 25 Synaptosomal-associated 25 kDa protein Super protein Snap25 Snap protein protein mouse Mus musculus Mouse MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG stx1a_mouse Syntaxin-1A Stx1a Neuron-specific antigen HPC-1 protein protein mouse Mus musculus Mouse MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLETSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIIIASTIGGIFG vamp2_mouse Vesicle-associated membrane protein 2 Vamp2 Syb2 Synaptobrevin-2 protein protein mouse Mus musculus Mouse MSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST snap25-stx1a-12 3152649 N/A 3152651 unspecified role unspecified role bait bait ecolx Escherichia coli N/A 3152652 unspecified role unspecified role prey prey Region 1-265 Region 1-265 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false snap25-vamp2-1 3152650 N/A 3152651 unspecified role unspecified role bait bait ecolx Escherichia coli N/A 3152653 unspecified role unspecified role prey prey Region 1-96 Region 1-96 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false