DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ arai-2007-1 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Arai S., Miyake K., Voit R., Nemoto S., Wakeland EK., Grummt I., Miyazaki T. DIP original experiment: DIP-261040X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Death-effector domain-containing protein DEDD is an inhibitor of mitotic Cdk1/cyclin B1. Arai S., Miyake K., Voit R., Nemoto S., Wakeland EK., Grummt I., Miyazaki T. Only protein-protein interactions imex curation arai-2007-2 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Arai S., Miyake K., Voit R., Nemoto S., Wakeland EK., Grummt I., Miyazaki T. DIP original experiment: DIP-261044X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Death-effector domain-containing protein DEDD is an inhibitor of mitotic Cdk1/cyclin B1. Arai S., Miyake K., Voit R., Nemoto S., Wakeland EK., Grummt I., Miyazaki T. Only protein-protein interactions imex curation arai-2007-3 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Arai S., Miyake K., Voit R., Nemoto S., Wakeland EK., Grummt I., Miyazaki T. DIP original experiment: DIP-261042X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Death-effector domain-containing protein DEDD is an inhibitor of mitotic Cdk1/cyclin B1. Arai S., Miyake K., Voit R., Nemoto S., Wakeland EK., Grummt I., Miyazaki T. Only protein-protein interactions imex curation arai-2007-4 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Arai S., Miyake K., Voit R., Nemoto S., Wakeland EK., Grummt I., Miyazaki T. DIP original experiment: DIP-261048X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Death-effector domain-containing protein DEDD is an inhibitor of mitotic Cdk1/cyclin B1. Arai S., Miyake K., Voit R., Nemoto S., Wakeland EK., Grummt I., Miyazaki T. Only protein-protein interactions imex curation arai-2007-5 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Arai S., Miyake K., Voit R., Nemoto S., Wakeland EK., Grummt I., Miyazaki T. DIP original experiment: DIP-261046X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Death-effector domain-containing protein DEDD is an inhibitor of mitotic Cdk1/cyclin B1. Arai S., Miyake K., Voit R., Nemoto S., Wakeland EK., Grummt I., Miyazaki T. Only protein-protein interactions imex curation arai-2007-6 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Arai S., Miyake K., Voit R., Nemoto S., Wakeland EK., Grummt I., Miyazaki T. DIP original experiment: DIP-261045X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Death-effector domain-containing protein DEDD is an inhibitor of mitotic Cdk1/cyclin B1. Arai S., Miyake K., Voit R., Nemoto S., Wakeland EK., Grummt I., Miyazaki T. Only protein-protein interactions imex curation arai-2007-7 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Arai S., Miyake K., Voit R., Nemoto S., Wakeland EK., Grummt I., Miyazaki T. DIP original experiment: DIP-261041X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Death-effector domain-containing protein DEDD is an inhibitor of mitotic Cdk1/cyclin B1. Arai S., Miyake K., Voit R., Nemoto S., Wakeland EK., Grummt I., Miyazaki T. Only protein-protein interactions imex curation arai-2007-8 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Arai S., Miyake K., Voit R., Nemoto S., Wakeland EK., Grummt I., Miyazaki T. DIP original experiment: DIP-261043X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Death-effector domain-containing protein DEDD is an inhibitor of mitotic Cdk1/cyclin B1. Arai S., Miyake K., Voit R., Nemoto S., Wakeland EK., Grummt I., Miyazaki T. Only protein-protein interactions imex curation arai-2007-9 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Arai S., Miyake K., Voit R., Nemoto S., Wakeland EK., Grummt I., Miyazaki T. DIP original experiment: DIP-261047X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Death-effector domain-containing protein DEDD is an inhibitor of mitotic Cdk1/cyclin B1. Arai S., Miyake K., Voit R., Nemoto S., Wakeland EK., Grummt I., Miyazaki T. Only protein-protein interactions imex curation ccnb1_human G2/mitotic-specific cyclin-B1 CCNB1 CCNB protein protein human Homo sapiens Human MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV o75618-1 Death effector domain-containing protein DEDD DEDPRO1 DEFT DEDPro1 Death effector domain-containing testicular molecule FLDED-1 KE05 protein protein human Homo sapiens Human MAGLKRRASQVWPEEHGEQEHGLYSLHRMFDIVGTHLTHRDVRVLSFLFVDVIDDHERGLIRNGRDFLLALERQGRCDESNFRQVLQLLRIITRHDLLPYVTLKRRRAVCPDLVDKYLEETSIRYVTPRALSDPEPRPPQPSKTVPPHYPVVCCPTSGPQMCSKRPARGRATLGSQRKRRKSVTPDPKEKQTCDIRLRVRAEYCQHETALQGNVFSNKQDPLERQFERFNQANTILKSRDLGSIICDIKFSELTYLDAFWRDYINGSLLEALKGVFITDSLKQAVGHEAIKLLVNVDEEDYELGRQKLLRNLMLQALP cdk1_human Cyclin-dependent kinase 1 p34 protein kinase Cell division protein kinase 1 CDK1 CDC2 Cell division control protein 2 homolog CDC28A CDKN1 P34CDC2 protein protein human Homo sapiens Human MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRHPNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCHSRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM dedd_human Death effector domain-containing protein DEDPro1 Death effector domain-containing testicular molecule FLDED-1 DEDD DEDPRO1 DEFT KE05 protein protein human Homo sapiens Human MAGLKRRASQVWPEEHGEQEHGLYSLHRMFDIVGTHLTHRDVRVLSFLFVDVIDDHERGLIRNGRDFLLALERQGRCDESNFRQVLQLLRIITRHDLLPYVTLKRRRAVCPDLVDKYLEETSIRYVTPRALSDPEPRPPQPSKTVPPHYPVVCCPTSGPQMCSKRPARGRATLGSQRKRRKSVTPDPKEKQTCDIRLRVRAEYCQHETALQGNVFSNKQDPLERQFERFNQANTILKSRDLGSIICDIKFSELTYLDAFWRDYINGSLLEALKGVFITDSLKQAVGHEAIKLLVNVDEEDYELGRQKLLRNLMLQALP cdk1-ccnb1-1 3152594 N/A 3152603 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3152604 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human N/A 3152605 unspecified role unspecified role bait bait human Homo sapiens Human association association false false false dedd-ccnb1-1 3152595 N/A 3152603 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3152604 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false ccnb1-cdk1-2 3152596 N/A 3152603 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3152605 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false dedd-cdk1-1 3152597 N/A 3152604 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human N/A 3152605 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false cdk1-ccnb1-2 3152598 N/A 3152603 unspecified role unspecified role prey prey GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3152605 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false ccnb1-cdk1-3 3152599 N/A 3152603 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3152604 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human N/A 3152605 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false cdk1-ccnb1-3 3152600 N/A 3152603 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3152606 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3152605 unspecified role unspecified role bait bait human Homo sapiens Human association association false false false ccnb1-dedd-1 3152601 N/A 3152603 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3152604 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Region 109-318 Region 109-318 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false cdk1-ccnb1-4 3152602 N/A 3152603 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3152605 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false