DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ gruswitz-2007-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Gruswitz F., O'Connell J., Stroud RM. DIP original experiment: DIP-260541X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Inhibitory complex of the transmembrane ammonia channel, AmtB, and the cytosolic regulatory protein, GlnK, at 1.96 A. Gruswitz F., O'Connell J., Stroud RM. Only protein-protein interactions imex curation glnk_ecoli Nitrogen regulatory protein GlnK ybaI glnK b0450 JW0440 Nitrogen regulatory protein P-II 2 PII-like protein protein protein ecoli Escherichia coli (strain K12) MKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAELYRGAEYSVNFLPKVKIDVAIADDQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVIRIRTGEADEAAL amtb_ecoli Ammonium transporter AmtB ybaG JW0441 b0451 amtB Ammonia channel AmtB Ammonium channel AmtB protein protein ecoli Escherichia coli (strain K12) MKIATIKTGLASLAMLPGLVMAAPAVADKADNAFMMICTALVLFMTIPGIALFYGGLIRGKNVLSMLTQVTVTFALVCILWVVYGYSLAFGEGNNFFGNINWLMLKNIELTAVMGSIYQYIHVAFQGSFACITVGLIVGALAERIRFSAVLIFVVVWLTLSYIPIAHMVWGGGLLASHGALDFAGGTVVHINAAIAGLVGAYLIGKRVGFGKEAFKPHNLPMVFTGTAILYIGWFGFNAGSAGTANEIAALAFVNTVVATAAAILGWIFGEWALRGKPSLLGACSGAIAGLVGVTPACGYIGVGGALIIGVVAGLAGLWGVTMLKRLLRVDDPCDVFGVHGVCGIVGCIMTGIFAASSLGGVGFAEGVTMGHQLLVQLESIAITIVWSGVVAFIGYKLADLTVGLRVPEEQEREGLDVNSHGENAYNA amtb-glnk-1 3151734 N/A 3151735 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3151736 unspecified role unspecified role unspecified role unspecified role Region 23-428 Region 23-428 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false