DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ shang-2006-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Shang Y., Li X., Cui H., He P., Thilmony R., Chintamanani S., Zwiesler-Vollick J., Gopalan S., Tang X., Zhou JM. DIP original experiment: DIP-264264X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx RAR1, a central player in plant immunity, is targeted by Pseudomonas syringae effector AvrB. Shang Y., Li X., Cui H., He P., Thilmony R., Chintamanani S., Zwiesler-Vollick J., Gopalan S., Tang X., Zhou JM. Only protein-protein interactions imex curation shang-2006-2 arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Shang Y., Li X., Cui H., He P., Thilmony R., Chintamanani S., Zwiesler-Vollick J., Gopalan S., Tang X., Zhou JM. DIP original experiment: DIP-264262X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx RAR1, a central player in plant immunity, is targeted by Pseudomonas syringae effector AvrB. Shang Y., Li X., Cui H., He P., Thilmony R., Chintamanani S., Zwiesler-Vollick J., Gopalan S., Tang X., Zhou JM. Only protein-protein interactions imex curation shang-2006-3 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Shang Y., Li X., Cui H., He P., Thilmony R., Chintamanani S., Zwiesler-Vollick J., Gopalan S., Tang X., Zhou JM. DIP original experiment: DIP-264265X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx RAR1, a central player in plant immunity, is targeted by Pseudomonas syringae effector AvrB. Shang Y., Li X., Cui H., He P., Thilmony R., Chintamanani S., Zwiesler-Vollick J., Gopalan S., Tang X., Zhou JM. Only protein-protein interactions imex curation shang-2006-4 arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Shang Y., Li X., Cui H., He P., Thilmony R., Chintamanani S., Zwiesler-Vollick J., Gopalan S., Tang X., Zhou JM. DIP original experiment: DIP-264263X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx RAR1, a central player in plant immunity, is targeted by Pseudomonas syringae effector AvrB. Shang Y., Li X., Cui H., He P., Thilmony R., Chintamanani S., Zwiesler-Vollick J., Gopalan S., Tang X., Zhou JM. Only protein-protein interactions imex curation rar1_arath Cysteine and histidine-rich domain-containing protein RAR1 RAR1 At5g51700 PBS2 RPR2 AtRAR1 CHORD domain-containing protein RAR1 Protein PPHB SUSCEPTIBLE 2 Protein REQUIRED FOR MLA12 RESISTANCE 1 MIO24.17 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEVGSATKKLQCQRIGCNAMFTDDDNPQGSCQFHASGPFFHDGMKEWSCCKQRSHDFSLFLEIPGCKTGKHTTEKPVLAKSVPKHPVAAPTSSPDANAATKDSCSRCRQGFFCSDHGSQPKEQIKQTLNTPGQAEEEKIEPLAPPVQKAVIDINQPQVCKNKGCGQTFKERDNHETACSHHPGPAVFHDRLRGWKCCDVHVKEFDEFMEIPPCTKGWHSSSPDPAV sgt1b_arath Protein SGT1 homolog B SGT1B EDM1 ETA3 At4g11260 RPR1 Protein ENHANCED DOWNY MILDEW 1 Protein ENHANCER OF TIR1-1 AUXIN RESISTANCE 3 Suppressor of G2 allele of SKP1 homolog B F8L21.50 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAKELAEKAKEAFLDDDFDVAVDLYSKAIDLDPNCAAFFADRAQANIKIDNFTEAVVDANKAIELEPTLAKAYLRKGTACMKLEEYSTAKAALEKGASVAPNEPKFKKMIDECDLRIAEEEKDLVQPMPPSLPSSSTTPLATEADAPPVPIPAAPAKPMFRHEFYQKPEEAVVTIFAKKVPKENVTVEFGEQILSVVIDVAGEEAYHLQPRLFGKIIPEKCRFEVLSTKVEIRLAKAEIITWASLEYGKGQSVLPKPNVSSALSQRPVYPSSKPAKDWDKLEAEVKKQEKDEKLDGDAAMNKFFSDIYSSADEDMRRAMNKSFAESNGTVLSTNWKEVGTKKVESTPPDGMELKKWEY avrb_psesg Avirulence protein B avrB protein protein psesg Pseudomonas savastanoi pv. glycinea Pseudomonas syringae pv. glycinea MGCVSSKSTTVLSPQTSFNEASRTSFRALPGPSQRQLEVYDQCLIGAARWPDDSSKSNTPENRAYCQSMYNSIRSAGDEISRGGITSFEELWGRATEWRLSKLQRGEPLYSAFASERTSDTDAVTPLVKPYKSVLARVVDHEDAHDEIMQDNLFGDLNVKVYRQTAYLHGNVIPLNTFRVATDTEYLRDRVAHLRTELGAKALKQHLQRYNPDRIDHTNASYLPIIKDHLNDLYRQAISSDLSQAELISLIARTHWWAASAMPDQRGSAAKAEFAARAIASAHGIELPPFRNGNVSDIEAMLSGEEEFVEKYRSLLDSDCF hs901_arath Heat shock protein 90-1 HSP90-1 HSP83 F6N7.13 At5g52640 Heat shock protein 83 HSP81-1 Heat shock protein 81-1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQPELFIRLVPDKSNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQFGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGRGTKITLFLKDDQLEYLEERRLKDLVKKHSEFISYPIYLWTEKTTEKEISDDEDEDEPKKENEGEVEEVDEEKEKDGKKKKKIKEVSHEWELINKQKPIWLRKPEEITKEEYAAFYKSLTNDWEDHLAVKHFSVEGQLEFKAILFVPKRAPFDLFDTRKKLNNIKLYVRRVFIMDNCEELIPEYLSFVKGVVDSDDLPLNISRETLQQNKILKVIRKNLVKKCIEMFNEIAENKEDYTKFYEAFSKNLKLGIHEDSQNRGKIADLLRYHSTKSGDEMTSFKDYVTRMKEGQKDIFYITGESKKAVENSPFLERLKKRGYEVLYMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLEDETEEEKKKREEKKKSFENLCKTIKEILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSGYMSSKKTMEINPDNGIMEELRKRAEADKNDKSVKDLVMLLYETALLTSGFSLDEPNTFAARIHRMLKLGLSIDEDENVEEDGDMPELEEDAAEESKMEEVD rin4_arath RPM1-interacting protein 4 RIN4 MJL12_1 At3g25070 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MARSNVPKFGNWEAEENVPYTAYFDKARKTRAPGSKIMNPNDPEYNSDSQSQAPPHPPSSRTKPEQVDTVRRSREHMRSREESELKQFGDAGGSSNEAANKRQGRASQNNSYDNKSPLHKNSYDGTGKSRPKPTNLRADESPEKVTVVPKFGDWDENNPSSADGYTHIFNKVREERSSGANVSGSSRTPTHQSSRNPNNTSSCCCFGFGGK sgt1b-rar1-1 3151027 N/A 3151031 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3151032 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false avrb-rar1-1 3151028 N/A 3151031 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress N/A 3151033 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false hsp90_1-rar1-1 3151029 N/A 3151034 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3151031 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false rin4-avrb-1 3151030 N/A 3151035 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress N/A 3151033 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false