DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ shen-2006-16 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Shen L., Tatham MH., Dong C., Zagórska A., Naismith JH., Hay RT. DIP original experiment: DIP-66582X Nature structural & molecular biology 2006 IMEx SUMO protease SENP1 induces isomerization of the scissile peptide bond. Shen L., Tatham MH., Dong C., Zagórska A., Naismith JH., Hay RT. Only protein-protein interactions imex curation shen-2006-17 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Shen L., Tatham MH., Dong C., Zagórska A., Naismith JH., Hay RT. DIP original experiment: DIP-66583X Nature structural & molecular biology 2006 IMEx SUMO protease SENP1 induces isomerization of the scissile peptide bond. Shen L., Tatham MH., Dong C., Zagórska A., Naismith JH., Hay RT. Only protein-protein interactions imex curation shen-2006-18 in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Shen L., Tatham MH., Dong C., Zagórska A., Naismith JH., Hay RT. DIP original experiment: DIP-66584X Nature structural & molecular biology 2006 IMEx SUMO protease SENP1 induces isomerization of the scissile peptide bond. Shen L., Tatham MH., Dong C., Zagórska A., Naismith JH., Hay RT. Only protein-protein interactions imex curation shen-2006-19 in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Shen L., Tatham MH., Dong C., Zagórska A., Naismith JH., Hay RT. DIP original experiment: DIP-66585X Nature structural & molecular biology 2006 IMEx SUMO protease SENP1 induces isomerization of the scissile peptide bond. Shen L., Tatham MH., Dong C., Zagórska A., Naismith JH., Hay RT. Only protein-protein interactions imex curation shen-2006-20 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Shen L., Tatham MH., Dong C., Zagórska A., Naismith JH., Hay RT. DIP original experiment: DIP-66586X Nature structural & molecular biology 2006 IMEx SUMO protease SENP1 induces isomerization of the scissile peptide bond. Shen L., Tatham MH., Dong C., Zagórska A., Naismith JH., Hay RT. Only protein-protein interactions imex curation shen-2006-21 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Shen L., Tatham MH., Dong C., Zagórska A., Naismith JH., Hay RT. DIP original experiment: DIP-66587X Nature structural & molecular biology 2006 IMEx SUMO protease SENP1 induces isomerization of the scissile peptide bond. Shen L., Tatham MH., Dong C., Zagórska A., Naismith JH., Hay RT. Only protein-protein interactions imex curation shen-2006-22 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Shen L., Tatham MH., Dong C., Zagórska A., Naismith JH., Hay RT. DIP original experiment: DIP-66588X Nature structural & molecular biology 2006 IMEx SUMO protease SENP1 induces isomerization of the scissile peptide bond. Shen L., Tatham MH., Dong C., Zagórska A., Naismith JH., Hay RT. Only protein-protein interactions imex curation shen-2006-23 in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Shen L., Tatham MH., Dong C., Zagórska A., Naismith JH., Hay RT. DIP original experiment: DIP-66589X Nature structural & molecular biology 2006 IMEx SUMO protease SENP1 induces isomerization of the scissile peptide bond. Shen L., Tatham MH., Dong C., Zagórska A., Naismith JH., Hay RT. Only protein-protein interactions imex curation shen-2006-24 in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Shen L., Tatham MH., Dong C., Zagórska A., Naismith JH., Hay RT. DIP original experiment: DIP-66590X Nature structural & molecular biology 2006 IMEx SUMO protease SENP1 induces isomerization of the scissile peptide bond. Shen L., Tatham MH., Dong C., Zagórska A., Naismith JH., Hay RT. Only protein-protein interactions imex curation shen-2006-25 in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Shen L., Tatham MH., Dong C., Zagórska A., Naismith JH., Hay RT. DIP original experiment: DIP-66591X Nature structural & molecular biology 2006 IMEx SUMO protease SENP1 induces isomerization of the scissile peptide bond. Shen L., Tatham MH., Dong C., Zagórska A., Naismith JH., Hay RT. Only protein-protein interactions imex curation shen-2006-26 in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Shen L., Tatham MH., Dong C., Zagórska A., Naismith JH., Hay RT. DIP original experiment: DIP-66592X Nature structural & molecular biology 2006 IMEx SUMO protease SENP1 induces isomerization of the scissile peptide bond. Shen L., Tatham MH., Dong C., Zagórska A., Naismith JH., Hay RT. Only protein-protein interactions imex curation senp1_human Sentrin-specific protease 1 SENP1 Sentrin/SUMO-specific protease SENP1 protein protein human Homo sapiens Human MDDIADRMRMDAGEVTLVNHNSVFKTHLLPQTGFPEDQLSLSDQQILSSRQGHLDRSFTCSTRSAAYNPSYYSDNPSSDSFLGSGDLRTFGQSANGQWRNSTPSSSSSLQKSRNSRSLYLETRKTSSGLSNSFAGKSNHHCHVSAYEKSFPIKPVPSPSWSGSCRRSLLSPKKTQRRHVSTAEETVQEEEREIYRQLLQMVTGKQFTIAKPTTHFPLHLSRCLSSSKNTLKDSLFKNGNSCASQIIGSDTSSSGSASILTNQEQLSHSVYSLSSYTPDVAFGSKDSGTLHHPHHHHSVPHQPDNLAASNTQSEGSDSVILLKVKDSQTPTPSSTFFQAELWIKELTSVYDSRARERLRQIEEQKALALQLQNQRLQEREHSVHDSVELHLRVPLEKEIPVTVVQETQKKGHKLTDSEDEFPEITEEMEKEIKNVFRNGNQDEVLSEAFRLTITRKDIQTLNHLNWLNDEIINFYMNMLMERSKEKGLPSVHAFNTFFFTKLKTAGYQAVKRWTKKVDVFSVDILLVPIHLGVHWCLAVVDFRKKNITYYDSMGGINNEACRILLQYLKQESIDKKRKEFDTNGWQLFSKKSQEIPQQMNGSDCGMFACKYADCITKDRPINFTQQHMPYFRKRMVWEILHRKLL ragp1_human Ran GTPase-activating protein 1 RANGAP1 KIAA1835 SD protein protein human Homo sapiens Human MASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDSLEALRLEGNTVGVEAARVIAKALEKKSELKRCHWSDMFTGRLRTEIPPALISLGEGLITAGAQLVELDLSDNAFGPDGVQGFEALLKSSACFTLQELKLNNCGMGIGGGKILAAALTECHRKSSAQGKPLALKVFVAGRNRLENDGATALAEAFRVIGTLEEVHMPQNGINHPGITALAQAFAVNPLLRVINLNDNTFTEKGAVAMAETLKTLRQVEVINFGDCLVRSKGAVAIADAIRGGLPKLKELNLSFCEIKRDAALAVAEAMADKAELEKLDLNGNTLGEEGCEQLQEVLEGFNMAKVLASLSDDEDEEEEEEGEEEEEEAEEEEEEDEEEEEEEEEEEEEEPQQRGQGEKSATPSRKILDPNTGEPAPVLSSPPPADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV sumo1_human Small ubiquitin-related modifier 1 SUMO1 Sentrin Ubiquitin-like protein SMT3C Ubiquitin-homology domain protein PIC1 Ubiquitin-like protein UBL1 GAP-modifying protein 1 SMT3 homolog 3 SMT3C SMT3H3 UBL1 OK/SW-cl.43 protein protein human Homo sapiens Human MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV sumo2_human Small ubiquitin-related modifier 2 SMT3 homolog 2 Sentrin-2 HSMT3 SUMO-3 SUMO2 SMT3H2 SMT3B Ubiquitin-like protein SMT3B protein protein human Homo sapiens Human MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY rangap1-senp1-1 3150417 N/A 3150428 unspecified role unspecified role neutral component neutral component 415-644 binding region 415-644 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false Q9P0U3:p.Cys603Ala C603A mutation mutation mutation predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3150429 unspecified role unspecified role neutral component neutral component 418-587 binding region 418-587 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3150430 unspecified role unspecified role neutral component neutral component 1-97 binding region 1-97 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false senp1-sumo1-5 3150418 N/A 3150428 unspecified role unspecified role neutral component neutral component 415-644 binding region 415-644 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false Q9P0U3:p.Cys603Ala C603A mutation mutation mutation predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3150430 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli direct interaction direct interaction false false false senp1-sumo1-6 3150419 N/A 3150428 unspecified role unspecified role unspecified role unspecified role 415-644 binding region 415-644 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false Q9P0U3:p.Cys603Ala C603A mutation mutation mutation predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3150430 unspecified role unspecified role fret pair fluorescence acceptor donor pair fret pair YFP Tag YFP Tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range false CFP Tag CFP Tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false senp1-sumo2-5 3150420 N/A 3150431 unspecified role unspecified role fret pair fluorescence acceptor donor pair fret pair CFP Tag CFP Tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false YFP Tag YFP Tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3150428 unspecified role unspecified role neutral component neutral component 415-644 binding region 415-644 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false Q9P0U3:p.Cys603Ala C603A mutation mutation mutation predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false rangap1-senp1-2 3150421 N/A 3150428 unspecified role unspecified role neutral component neutral component 415-644 binding region 415-644 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false Q9P0U3:p.Cys603Ala C603A mutation mutation mutation predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3150429 unspecified role unspecified role neutral component neutral component 418-587 binding region 418-587 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3150430 unspecified role unspecified role neutral component neutral component 1-97 binding region 1-97 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false senp1-sumo1-7 3150422 N/A 3150428 unspecified role unspecified role neutral component neutral component 415-644 binding region 415-644 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false Q9P0U3:p.Cys603Ala C603A mutation mutation mutation predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3150430 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli direct interaction direct interaction false false false senp1-sumo2-6 3150423 N/A 3150431 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli N/A 3150428 unspecified role unspecified role neutral component neutral component 415-644 binding region 415-644 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false Q9P0U3:p.Cys603Ala C603A mutation mutation mutation predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false senp1-sumo1-8 3150424 N/A 3150428 enzyme enzyme unspecified role unspecified role region region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3150430 enzyme target enzyme target substrate substrate fret pair fluorescence acceptor donor pair fret pair YFP Tag YFP Tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range false CFP Tag CFP Tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false senp1-sumo2-7 3150425 N/A 3150431 enzyme target enzyme target substrate substrate fret pair fluorescence acceptor donor pair fret pair CFP Tag CFP Tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false YFP Tag YFP Tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3150428 enzyme enzyme neutral component neutral component 415-644 binding region 415-644 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false sumo1-rangap1-2 3150426 N/A 3150428 enzyme enzyme neutral component neutral component 415-644 binding region 415-644 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3150429 enzyme target enzyme target substrate substrate fluorescence accept fluorescence acceptor fluorescence accept 418-587 binding region 418-587 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false YFP Tag YFP Tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3150430 enzyme target enzyme target substrate substrate fluorescence donor fluorescence donor 1-97 binding region 1-97 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false CFP Tag CFP Tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false sumo2-rangap1-1 3150427 N/A 3150431 enzyme target enzyme target substrate substrate fluorescence donor fluorescence donor CFP Tag CFP Tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3150428 enzyme enzyme neutral component neutral component 415-644 binding region 415-644 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3150429 enzyme target enzyme target substrate substrate fluorescence accept fluorescence acceptor fluorescence accept 418-587 binding region 418-587 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false YFP Tag YFP Tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false