DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ yang-2006-26 in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. DIP original experiment: DIP-264152X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for protein-protein interactions in the 14-3-3 protein family. Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. Only protein-protein interactions imex curation yang-2006-27 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. DIP original experiment: DIP-264138X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for protein-protein interactions in the 14-3-3 protein family. Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. Only protein-protein interactions imex curation yang-2006-28 ecolx Escherichia coli ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. DIP original experiment: DIP-264145X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for protein-protein interactions in the 14-3-3 protein family. Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. Only protein-protein interactions imex curation yang-2006-29 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. DIP original experiment: DIP-264139X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for protein-protein interactions in the 14-3-3 protein family. Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. Only protein-protein interactions imex curation yang-2006-30 ecolx Escherichia coli ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. DIP original experiment: DIP-264146X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for protein-protein interactions in the 14-3-3 protein family. Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. Only protein-protein interactions imex curation yang-2006-31 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. DIP original experiment: DIP-264140X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for protein-protein interactions in the 14-3-3 protein family. Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. Only protein-protein interactions imex curation yang-2006-32 in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. DIP original experiment: DIP-264153X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for protein-protein interactions in the 14-3-3 protein family. Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. Only protein-protein interactions imex curation yang-2006-33 ecolx Escherichia coli ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. DIP original experiment: DIP-264147X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for protein-protein interactions in the 14-3-3 protein family. Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. Only protein-protein interactions imex curation yang-2006-34 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. DIP original experiment: DIP-264141X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for protein-protein interactions in the 14-3-3 protein family. Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. Only protein-protein interactions imex curation yang-2006-35 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. DIP original experiment: DIP-264142X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for protein-protein interactions in the 14-3-3 protein family. Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. Only protein-protein interactions imex curation yang-2006-36 in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. DIP original experiment: DIP-264155X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for protein-protein interactions in the 14-3-3 protein family. Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. Only protein-protein interactions imex curation yang-2006-37 ecolx Escherichia coli ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. DIP original experiment: DIP-264148X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for protein-protein interactions in the 14-3-3 protein family. Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. Only protein-protein interactions imex curation yang-2006-38 in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. DIP original experiment: DIP-264154X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for protein-protein interactions in the 14-3-3 protein family. Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. Only protein-protein interactions imex curation yang-2006-39 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. DIP original experiment: DIP-264143X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for protein-protein interactions in the 14-3-3 protein family. Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. Only protein-protein interactions imex curation yang-2006-40 ecolx Escherichia coli ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. DIP original experiment: DIP-264149X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for protein-protein interactions in the 14-3-3 protein family. Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. Only protein-protein interactions imex curation yang-2006-41 in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. DIP original experiment: DIP-264150X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for protein-protein interactions in the 14-3-3 protein family. Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. Only protein-protein interactions imex curation yang-2006-42 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. DIP original experiment: DIP-264144X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for protein-protein interactions in the 14-3-3 protein family. Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. Only protein-protein interactions imex curation yang-2006-43 in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. DIP original experiment: DIP-264151X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for protein-protein interactions in the 14-3-3 protein family. Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. Only protein-protein interactions imex curation 1433t_human 14-3-3 protein theta YWHAQ 14-3-3 protein tau 14-3-3 protein T-cell Protein HS1 protein protein human Homo sapiens Human MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN 1433b_human 14-3-3 protein beta/alpha YWHAB Protein kinase C inhibitor protein 1 Protein 1054 protein protein human Homo sapiens Human MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN 1433e_human 14-3-3 protein epsilon YWHAE protein protein human Homo sapiens Human MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ 1433f_human 14-3-3 protein eta YWHAH YWHA1 Protein AS1 protein protein human Homo sapiens Human MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN 1433g_human 14-3-3 protein gamma YWHAG Protein kinase C inhibitor protein 1 protein protein human Homo sapiens Human MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN q51451_pseai exoS protein protein pseai Pseudomonas aeruginosa MHIQSLQQSPSFAVELHQAASGRLGQIEARQVATPSEAQQLAQRQDAPKGEGLLARLGAALMRPFVAIMDWLGKLLGSHARTGPQPSQDAQPAVMSSAVVFKQMVLQQALPMTLKGLDKASELATLTPEGLAREHSRLASGDGALRSLSTALAGIRAGSQVEESRIQAGRLLERSIGGIALQQWGTTGGAASQLVLDASPELRREITDQLHQVMSEVALLRQAVESEVSRVSADKALADGLVKRFGADAEKYLGRQPGGIHSDAEVMALGLYTGIHYADLNRALRQGQELDAGQKLIDQGMSAAFEKSGQAEQVVKTFRGTRGGDAFNAVEEGKVGHDDGYLSTSLNPGVARSFGQGTISTVFGRSGIDVSGISNYKNEKEILYNKETDMRVLLSASDEQGVTRRVLEEAALGEQSGHSQGLLDALDLASKPERSGEVQEQDVRLRMRGLDLA ywhab-ywhaq-1 3150030 N/A 3150048 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3150049 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false ywhae-1 3150031 N/A 3150050 unspecified role unspecified role unspecified role unspecified role Region 1-233 Region 1-233 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ywhab-1 3150032 N/A 3150049 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false ywhaq-1 3150033 N/A 3150048 unspecified role unspecified role unspecified role unspecified role Region 1-234 Region 1-234 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ywhae-2 3150034 N/A 3150050 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false ywhah-1 3150035 N/A 3150051 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false ywhae-ywhag-1 3150036 N/A 3150050 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3150052 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false ywhag-1 3150037 N/A 3150052 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false ywhag-2 3150038 N/A 3150052 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false ywhah-2 3150039 N/A 3150051 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false ywhag-ywhaq-1 3150040 N/A 3150052 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3150048 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false ywhah-3 3150041 N/A 3150051 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false ywhae-ywhaq-1 3150042 N/A 3150048 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3150050 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false ywhab-2 3150043 N/A 3150049 unspecified role unspecified role unspecified role unspecified role Region 1-239 Region 1-239 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ywhaq-2 3150044 N/A 3150048 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false ywhab-ywhae-1 3150045 N/A 3150050 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3150049 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false exos-ywhab-2 3150046 N/A 3150053 unspecified role unspecified role unspecified role unspecified role Region 421-431 Region 421-431 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3150049 unspecified role unspecified role unspecified role unspecified role Region 1-239 Region 1-239 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ywhab-ywhag-1 3150047 N/A 3150052 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3150049 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false