DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ lin-2006-4 ecolx Escherichia coli dls dynamic light scattering dls predetermined predetermined participant predetermined Lin Z., Sriskanthadevan S., Huang H., Siu CH., Yang D. DIP original experiment: DIP-66575X Nature structural & molecular biology 2006 IMEx Solution structures of the adhesion molecule DdCAD-1 reveal new insights into Ca(2+)-dependent cell-cell adhesion. Lin Z., Sriskanthadevan S., Huang H., Siu CH., Yang D. Only protein-protein interactions imex curation lin-2006-5 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Lin Z., Sriskanthadevan S., Huang H., Siu CH., Yang D. DIP original experiment: DIP-66576X Nature structural & molecular biology 2006 IMEx Solution structures of the adhesion molecule DdCAD-1 reveal new insights into Ca(2+)-dependent cell-cell adhesion. Lin Z., Sriskanthadevan S., Huang H., Siu CH., Yang D. Only protein-protein interactions imex curation cad1_dicdi Calcium-dependent cell adhesion molecule 1 cadA cad1 GP24 DDB_G0285793 protein protein dicdi Dictyostelium discoideum (Slime mold) Slime mold MSVDANKVKFFFGKNCTGESFEYNKGETVRFNNGDKWNDKFMSCLVGSNVRCNIWEHNEIDTPTPGKFQELAQGSTNNDLTSINGLSKFQVLPGAFQWAVDVKIVNKVNSTAGSYEMTITPYQVDKVACKDGDDFVQLPIPKLTPPDSEIVSHLTVRQTHTPYDYVVNGSVYFKYSPTTGQVTVIKKDETFPKNMTVTQDDNTSFIFNLNSEK mint cada-3 3149593 N/A 3149595 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli direct interaction direct interaction false false false cada-2 3149594 N/A 3149595 unspecified role unspecified role neutral component neutral component 2-93 binding region 2-93 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false P54657:p.Lys36Glu K36E mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false P54657:p.Lys40Glu K40E mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false