DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ pioletti-2006-1 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Pioletti M., Findeisen F., Hura GL., Minor DL. DIP original experiment: DIP-66572X Nature structural & molecular biology 2006 IMEx Three-dimensional structure of the KChIP1-Kv4.3 T1 complex reveals a cross-shaped octamer. Pioletti M., Findeisen F., Hura GL., Minor DL. Only protein-protein interactions imex curation pioletti-2006-2 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Pioletti M., Findeisen F., Hura GL., Minor DL. DIP original experiment: DIP-66570X Nature structural & molecular biology 2006 IMEx Three-dimensional structure of the KChIP1-Kv4.3 T1 complex reveals a cross-shaped octamer. Pioletti M., Findeisen F., Hura GL., Minor DL. Only protein-protein interactions imex curation pioletti-2006-3 ecolx Escherichia coli saxs x ray scattering saxs predetermined predetermined participant predetermined Pioletti M., Findeisen F., Hura GL., Minor DL. DIP original experiment: DIP-66571X Nature structural & molecular biology 2006 IMEx Three-dimensional structure of the KChIP1-Kv4.3 T1 complex reveals a cross-shaped octamer. Pioletti M., Findeisen F., Hura GL., Minor DL. Only protein-protein interactions imex curation kcnd3_rat Potassium voltage-gated channel subfamily D member 3 Kcnd3 Voltage-gated potassium channel subunit Kv4.3 protein protein rat Rattus norvegicus (Rat) Rat MAAGVAAWLPFARAAAIGWMPVANCPMPLAPADKNKRQDELIVLNVSGRRFQTWRTTLERYPDTLLGSTEKEFFFNEDTKEYFFDRDPEVFRCVLNFYRTGKLHYPRYECISAYDDELAFYGILPEIIGDCCYEEYKDRKRENAERLMDDNESENNQESMPSLSFRQTMWRAFENPHTSTLALVFYYVTGFFIAVSVITNVVETVPCGTVPGSKELPCGERYSVAFFCLDTACVMIFTVEYLLRLFAAPSRYRFIRSVMSIIDVVAIMPYYIGLVMTNNEDVSGAFVTLRVFRVFRIFKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASKFTSIPASFWYTIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRADKRRAQKKARLARIRVAKTGSSNAYLHSKRNGLLNEALELTGTPEEEHMGKTTSLIESQHHHLLHCLEKTTGLSYLVDDPLLSVRTSTIKNHEFIDEQMFEQNCMESSMQNYPSTRSPSLSSHSGLTTTCCSRRSKKTTHLPNSNLPATRLRSMQELSTIHIQGSEQPSLTTSRSSLNLKADDGLRPNCKTSQITTAIISIPTPPALTPEGESRPPPASPGPNTNIPSITSNVVKVSVL mint Pore-forming (alpha) subunit of voltage-gated rapidly inactivating A-type potassium channels. May contribute to I(To) current in heart and I(Sa) current in neurons. Channel properties are modulated by interactions with other alpha subunits and with regulatory subunits kcip1_human Kv channel-interacting protein 1 KCNIP1 KCHIP1 VABP A-type potassium channel modulatory protein 1 Potassium channel-interacting protein 1 Vesicle APC-binding protein protein protein human Homo sapiens Human MGAVMGTFSSLQTKQRRPSKDIAWWYYQYQRDKIEDELEMTMVCHRPEGLEQLEAQTNFTKRELQVLYRGFKNECPSGVVNEDTFKQIYAQFFPHGDASTYAHYLFNAFDTTQTGSVKFEDFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKEEMMDIVKAIYDMMGKYTYPVLKEDTPRQHVDVFFQKMDKNKDGIVTLDEFLESCQEDDNIMRSLQLFQNVM kcnd3-kcnip1-2 3149554 N/A 3149557 unspecified role unspecified role bait bait 1-143 binding region 1-143 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3149558 unspecified role unspecified role prey prey 37-216 binding region 37-216 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false Q9NZI2:p.[Asp146Ala;Asp194Ala] D135A, D183A mutation mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kcnd3-kcnip1-3 3149555 N/A 3149557 unspecified role unspecified role neutral component neutral component 1-143 binding region 1-143 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3149558 unspecified role unspecified role neutral component neutral component 37-216 binding region 37-216 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false kcnd3-kcnip1-4 3149556 N/A 3149557 unspecified role unspecified role neutral component neutral component 1-143 binding region 1-143 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3149558 unspecified role unspecified role neutral component neutral component 37-216 binding region 37-216 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false