DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ shiba-2006-1 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. DIP original experiment: DIP-263969X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. Only protein-protein interactions imex curation shiba-2006-2 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. DIP original experiment: DIP-263972X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. Only protein-protein interactions imex curation shiba-2006-3 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. DIP original experiment: DIP-263967X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. Only protein-protein interactions imex curation shiba-2006-4 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. DIP original experiment: DIP-263977X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. Only protein-protein interactions imex curation shiba-2006-5 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. DIP original experiment: DIP-263974X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. Only protein-protein interactions imex curation shiba-2006-6 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. DIP original experiment: DIP-263975X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. Only protein-protein interactions imex curation shiba-2006-7 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. DIP original experiment: DIP-263978X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. Only protein-protein interactions imex curation shiba-2006-8 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. DIP original experiment: DIP-263968X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. Only protein-protein interactions imex curation shiba-2006-9 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. DIP original experiment: DIP-263971X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. Only protein-protein interactions imex curation shiba-2006-10 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. DIP original experiment: DIP-263976X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. Only protein-protein interactions imex curation shiba-2006-11 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. DIP original experiment: DIP-263970X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. Only protein-protein interactions imex curation shiba-2006-12 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. DIP original experiment: DIP-263973X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. Only protein-protein interactions imex curation rb11a_human Ras-related protein Rab-11A YL8 RAB11A RAB11 protein protein human Homo sapiens Human MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQCCQNI o75154-1 Rab11 family-interacting protein 3 RAB11FIP3 ARFO1 KIAA0665 Arfophilin-1 EF hands-containing Rab-interacting protein MU-MB-17.148 protein protein human Homo sapiens Human MASAPPASPPGSEPPGPDPEPGGPDGPGAAQLAPGPAELRLGAPVGGPDPQSPGLDEPAPGAAADGGARWSAGPAPGLEGGPRDPGPSAPPPRSGPRGQLASPDAPGPGPRSEAPLPELDPLFSWTEEPEECGPASCPESAPFRLQGSSSSHRARGEVDVFSPFPAPTAGELALEQGPGSPPQPSDLSQTHPLPSEPVGSQEDGPRLRAVFDALDGDGDGFVRIEDFIQFATVYGAEQVKDLTKYLDPSGLGVISFEDFYQGITAIRNGDPDGQCYGGVASAQDEEPLACPDEFDDFVTYEANEVTDSAYMGSESTYSECETFTDEDTSTLVHPELQPEGDADSAGGSAVPSECLDAMEEPDHGALLLLPGRPHPHGQSVITVIGGEEHFEDYGEGSEAELSPETLCNGQLGCSDPAFLTPSPTKRLSSKKVARYLHQSGALTMEALEDPSPELMEGPEEDIADKVVFLERRVLELEKDTAATGEQHSRLRQENLQLVHRANALEEQLKEQELRACEMVLEETRRQKELLCKMEREKSIEIENLQTRLQQLDEENSELRSCTPCLKANIERLEEEKQKLLDEIESLTLRLSEEQENKRRMGDRLSHERHQFQRDKEATQELIEDLRKQLEHLQLLKLEAEQRRGRSSSMGLQEYHSRARESELEQEVRRLKQDNRNLKEQNEELNGQIITLSIQGAKSLFSTAFSESLAAEISSVSRDELMEAIQKQEEINFRLQDYIDRIIVAIMETNPSILEVK arf5_human ADP-ribosylation factor 5 ARF5 protein protein human Homo sapiens Human MGLTVSALFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR q86ys3-1 Rab11 family-interacting protein 4 RAB11FIP4 ARFO2 KIAA1821 Arfophilin-2 protein protein human Homo sapiens Human MAGGAGWSGAPAALLRSVRRLREVFEVCGRDPDGFLRVERVAALGLRFGQGEEVEKLVKYLDPNDLGRINFKDFCRGVFAMKGCEELLKDVLSVESAGTLPCAPEIPDCVEQGSEVTGPTFADGELIPREPGFFPEDEEEAMTLAPPEGPQELYTDSPMESTQSLEGSVGSPAEKDGGLGGLFLPEDKSLVHTPSMTTSDLSTHSTTSLISNEEQFEDYGEGDDVDCAPSSPCPDDETRTNVYSDLGSSVSSSAGQTPRKMRHVYNSELLDVYCSQCCKKINLLNDLEARLKNLKANSPNRKISSTAFGRQLMHSSNFSSSNGSTEDLFRDSIDSCDNDITEKVSFLEKKVTELENDSLTNGDLKSKLKQENTQLVHRVHELEEMVKDQETTAEQALEEEARRHREAYGKLEREKATEVELLNARVQQLEEENTELRTTVTRLKSQTEKLDEERQRMSDRLEDTSLRLKDEMDLYKRMMDKLRQNRLEFQKEREATQELIEDLRKELEHLQMYKLDCERPGRGRSASSGLGEFNARAREVELEHEVKRLKQENYKLRDQNDDLNGQILSLSLYEAKNLFAAQTKAQSLAAEIDTASRDELMEALKEQEEINFRLRQYMDKIILAILDHNPSILEIKH arf6_human ADP-ribosylation factor 6 ARF6 protein protein human Homo sapiens Human MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS rab11fip3-rab11a-1 3148976 N/A 3148988 unspecified role unspecified role prey prey P62491:p.Gln70Leu Q70L mutation mutation certain certain sequence position certain certain certain sequence position certain false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3148989 unspecified role unspecified role bait bait Region 733-756 Region 733-756 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false O75154-1:p.Tyr737Ser Y737S mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false O75154-1:p.Asp739Ala D739A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false O75154-1:p.Met746Ser M746S mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false O75154-1:p.Glu747Ala E747A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false rab11fip4-arf5-1 3148977 N/A 3148990 unspecified role unspecified role prey prey P84085:p.Gln71Leu Q71L mutation mutation certain certain sequence position certain certain certain sequence position certain false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3148991 unspecified role unspecified role bait bait Region 484-588 Region 484-588 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli physical association physical association false false false rab11a-rab11fip3-1 3148978 N/A 3148989 unspecified role unspecified role prey prey Region 607-756 Region 607-756 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3148988 unspecified role unspecified role bait bait P62491:p.Gln70Leu Q70L mutation mutation certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false rab11a-rab11fip3-2 3148979 N/A 3148989 unspecified role unspecified role prey prey T7-tag T7-tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli N/A 3148988 unspecified role unspecified role bait bait P62491:p.Gln70Leu Q70L mutation mutation certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false rab11fip4-arf6-2 3148980 N/A 3148992 unspecified role unspecified role prey prey P62330:p.Gln67Leu Q67L mutation mutation certain certain sequence position certain certain certain sequence position certain false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3148991 unspecified role unspecified role bait bait Region 484-637 Region 484-637 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli physical association physical association false false false rab11a-arf5-1 3148981 N/A 3148990 unspecified role unspecified role prey prey P84085:p.Gln71Leu Q71L mutation mutation certain certain sequence position certain certain certain sequence position certain false T7-tag T7-tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3148989 unspecified role unspecified role prey prey T7-tag T7-tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli N/A 3148988 unspecified role unspecified role bait bait P62491:p.Gln70Leu Q70L mutation mutation certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false rab11a-rab11fip3-3 3148982 N/A 3148989 unspecified role unspecified role unspecified role unspecified role Region 607-756 Region 607-756 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3148988 unspecified role unspecified role unspecified role unspecified role Region 1-173 Region 1-173 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P62491:p.Gln70Leu Q70L mutation mutation certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false rab11a-rab11fip4-1 3148983 N/A 3148991 unspecified role unspecified role prey prey Region 484-637 Region 484-637 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3148988 unspecified role unspecified role bait bait P62491:p.Gln70Leu Q70L mutation mutation certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false rab11fip3-arf5-1 3148984 N/A 3148990 unspecified role unspecified role prey prey P84085:p.Gln71Leu Q71L mutation mutation certain certain sequence position certain certain certain sequence position certain false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3148989 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Region 607-712 Region 607-712 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false rab11a-rab11fip3-4 3148985 N/A 3148989 unspecified role unspecified role unspecified role unspecified role Region 607-756 Region 607-756 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3148988 unspecified role unspecified role unspecified role unspecified role Region 1-173 Region 1-173 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P62491:p.Gln70Leu Q70L mutation mutation certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false rab11fip4-rab11a-1 3148986 N/A 3148988 unspecified role unspecified role prey prey P62491:p.Gln70Leu Q70L mutation mutation certain certain sequence position certain certain certain sequence position certain false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3148991 unspecified role unspecified role bait bait Region 613-637 Region 613-637 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli physical association physical association false false false rab11fip3-arf6-1 3148987 N/A 3148992 unspecified role unspecified role prey prey P62330:p.Gln67Leu Q67L mutation mutation certain certain sequence position certain certain certain sequence position certain false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3148989 unspecified role unspecified role bait bait Region 607-756 Region 607-756 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli physical association physical association false false false