DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ coles-2006-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Coles M., Hulko M., Djuranovic S., Truffault V., Koretke K., Martin J., Lupas AN. DIP original experiment: DIP-66372X Structure (London, England : 1993) 2006 IMEx Common evolutionary origin of swapped-hairpin and double-psi beta barrels. Coles M., Hulko M., Djuranovic S., Truffault V., Koretke K., Martin J., Lupas AN. Only protein-protein interactions imex curation coles-2006-2 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Coles M., Hulko M., Djuranovic S., Truffault V., Koretke K., Martin J., Lupas AN. DIP original experiment: DIP-66373X Structure (London, England : 1993) 2006 IMEx Common evolutionary origin of swapped-hairpin and double-psi beta barrels. Coles M., Hulko M., Djuranovic S., Truffault V., Koretke K., Martin J., Lupas AN. Only protein-protein interactions imex curation o58917_pyrho PH1179 protein protein pyrho Pyrococcus horikoshii MQNQQKTVEPLAKFHASVNIKGQLVVPVKDREVFGLKRGDILEIIVRSFDVINGKIHIKKRAYILVRLSSKGLITIPEEVRRELGISPGDTVEVLLVGFHKFDELVTEKGKQIAKLIQANTHMRLITSEEEKTIIEKSRTYYV 7C187F53D9C69F21 q9v2u9_mettf protein protein mettf Methanothermobacter thermautotrophicus Methanobacterium thermoformicicum MAMEDVGVPFSNRLTRQGNIKVPADLRDALKLKPGDLLVVEIKKVDRS ph1179-1 3148793 N/A 3148795 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false q9v2u9_mettf-1 3148794 N/A 3148796 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false