DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ angot-2006-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. DIP original experiment: DIP-263877X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Ralstonia solanacearum requires F-box-like domain-containing type III effectors to promote disease on several host plants. Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. Only protein-protein interactions imex curation angot-2006-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. DIP original experiment: DIP-263866X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Ralstonia solanacearum requires F-box-like domain-containing type III effectors to promote disease on several host plants. Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. Only protein-protein interactions imex curation angot-2006-3 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. DIP original experiment: DIP-263871X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Ralstonia solanacearum requires F-box-like domain-containing type III effectors to promote disease on several host plants. Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. Only protein-protein interactions imex curation angot-2006-4 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. DIP original experiment: DIP-263882X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Ralstonia solanacearum requires F-box-like domain-containing type III effectors to promote disease on several host plants. Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. Only protein-protein interactions imex curation angot-2006-5 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. DIP original experiment: DIP-263872X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Ralstonia solanacearum requires F-box-like domain-containing type III effectors to promote disease on several host plants. Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. Only protein-protein interactions imex curation angot-2006-6 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. DIP original experiment: DIP-263867X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Ralstonia solanacearum requires F-box-like domain-containing type III effectors to promote disease on several host plants. Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. Only protein-protein interactions imex curation angot-2006-7 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. DIP original experiment: DIP-263884X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Ralstonia solanacearum requires F-box-like domain-containing type III effectors to promote disease on several host plants. Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. Only protein-protein interactions imex curation angot-2006-8 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. DIP original experiment: DIP-263868X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Ralstonia solanacearum requires F-box-like domain-containing type III effectors to promote disease on several host plants. Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. Only protein-protein interactions imex curation angot-2006-9 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. DIP original experiment: DIP-263883X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Ralstonia solanacearum requires F-box-like domain-containing type III effectors to promote disease on several host plants. Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. Only protein-protein interactions imex curation angot-2006-10 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. DIP original experiment: DIP-263878X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Ralstonia solanacearum requires F-box-like domain-containing type III effectors to promote disease on several host plants. Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. Only protein-protein interactions imex curation angot-2006-11 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. DIP original experiment: DIP-263873X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Ralstonia solanacearum requires F-box-like domain-containing type III effectors to promote disease on several host plants. Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. Only protein-protein interactions imex curation angot-2006-12 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. DIP original experiment: DIP-263874X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Ralstonia solanacearum requires F-box-like domain-containing type III effectors to promote disease on several host plants. Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. Only protein-protein interactions imex curation angot-2006-13 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. DIP original experiment: DIP-263880X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Ralstonia solanacearum requires F-box-like domain-containing type III effectors to promote disease on several host plants. Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. Only protein-protein interactions imex curation angot-2006-14 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. DIP original experiment: DIP-263885X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Ralstonia solanacearum requires F-box-like domain-containing type III effectors to promote disease on several host plants. Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. Only protein-protein interactions imex curation angot-2006-15 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. DIP original experiment: DIP-263869X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Ralstonia solanacearum requires F-box-like domain-containing type III effectors to promote disease on several host plants. Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. Only protein-protein interactions imex curation angot-2006-16 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. DIP original experiment: DIP-263879X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Ralstonia solanacearum requires F-box-like domain-containing type III effectors to promote disease on several host plants. Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. Only protein-protein interactions imex curation angot-2006-17 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. DIP original experiment: DIP-263881X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Ralstonia solanacearum requires F-box-like domain-containing type III effectors to promote disease on several host plants. Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. Only protein-protein interactions imex curation angot-2006-18 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. DIP original experiment: DIP-263870X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Ralstonia solanacearum requires F-box-like domain-containing type III effectors to promote disease on several host plants. Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. Only protein-protein interactions imex curation angot-2006-19 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. DIP original experiment: DIP-263875X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Ralstonia solanacearum requires F-box-like domain-containing type III effectors to promote disease on several host plants. Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. Only protein-protein interactions imex curation angot-2006-20 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. DIP original experiment: DIP-263876X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Ralstonia solanacearum requires F-box-like domain-containing type III effectors to promote disease on several host plants. Angot A., Peeters N., Lechner E., Vailleau F., Baud C., Gentzbittel L., Sartorel E., Genschik P., Boucher C., Genin S. Only protein-protein interactions imex curation ask11_arath SKP1-like protein 11 ASK11 At4g34210 F10M10.2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSKMIVLMSSDGQSFEVEEAVAIQSQTIAHMVEDDCVADGIPLANVESKILVKVIEYCKKHHVDEANPISEEDLNNWDEKFMDLEQSTIFELILAANYLNIKSLLDLTCQTVADMIKGKTPEEIRSTFNIENDFTPEEEEAVRKENQWAFE q8xre0_ralso RSp0914 protein protein ralso ralso Pseudomonas solanacearum MGNQFSINRNRPANAGEAHASSTEAKPAPDAASPSRQVRVATAPSILEGLRKLRLPFNFGARVPPLPEETWAEIARRVDTKTLHRMRAVSKTLKAAADTEIRQLTVNTVEALQAAKRYACLETLKMDGYFGDADLEGLPASLRELDLFSTRYVSAKGLAHLSKLPLVRLKVRANGIHAEAARALAASTTLTALDIRGNGIGDAGAQALAANTSITSLDASFNDIGVAGARALAANTTLTSLDLGFNAIGDEGLQALATNTSLTSLTVGSCEIGDAGAAALANNTALTSVDLTCNHIGEEGAEGLAANTVLTSLDLTRNSISDRGAAALAGNTTLTSLCVNFNDIYGRGARWLAENTTLTTLDISYNPIGDWGALGLADNMTLRSLSVVAGRIGVEGARALAGNTTLTTLDISVNAIGNEGAQALAANATLTTLSLRSCELRAAAAEAFKANTTLASLDIGENRIEAAGAQALADNTALTTLRVTGNQIGMAGAQALAANRSLTKLNISQNDIRSAGAQALAANTSLTSLDVSSASIGAAGAQALAANTSITWLNINDNHIGDAGAQALAAHPALTSLYACDNFIGTAGVQALAANTRLTSLSIWGNRIGDAGVKALAANTTLTKLTIGKRVDKQLGEQIGDLAWQELMASVDRSGMTFHSL skp1a_arath SKP1-like protein 1A UFO-binding protein 1 SKP1 UIP1 At1g75950 T4O12.17 SKP1A ASK1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSAKKIVLKSSDGESFEVEEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCKRHVEAAASKAEAVEGAATSDDDLKAWDADFMKIDQATLFELILAANYLNIKNLLDLTCQTVADMIKGKTPEEIRTTFNIKNDFTPEEEEEVRRENQWAFE q8xzn9_ralso ripG RSc1356 protein protein ralso ralso Pseudomonas solanacearum MVSRIPTGNRGQGNGIEQSASSHATEATPWLGVNLPYGHWLPSSARSVVSRASSLLGGLANFRWGGRPASARPAPNIRSAAIAPAQQTLPPELWQQIATLAGARPRRAMREVSLELRNASRAVVTHLTISDPAMFRQLSLYPALKSVRFKGELTLEALKALPPELEHLEIGRCTGSAISAEGLAHLASMPLKSLNLNGIEIGVEGARTLAASKSLVSLSLIGCGIGDRAAQALVASRSIQCLDLSVNRIGRDGAQALAGAPLVSLNLHNNEIGNEGARVLATSRTLTSLDVSNNGVGNAGAEAFAGNTVLKQLSLAGGMISGDGAQALADNKSLTDLDLSNNRLGDAGAQALADSESFVSLKLGGNEIGADGAEALARNVVLQSLNLSYNPIGFWGVNALGRAKLRKLDLCACAIDSDGASALARNTSLASLYLGSNRIGDDGARALAKNSTLTLLNLSGNNIHAVGAQALASNDSLITLDLSRNGIGDDGTAALACHPRLTSLNLSRNQIGSTGAQQLAKSATLAELDLSENRIGPEGAEALARSTVLTTLNVSYNAIGEAGARALAESVSLTSLDARRNGIGEDGAKVLEANTRITGTPQNPNFLAEDVPRPDVRWRD q8xzn8_ralso RSc1357 protein protein ralso ralso Pseudomonas solanacearum MMFKRIDSSVFSPYVRPEPSAPPLPEQGAPSGRAANSASHPYIRPEPSAPLLPEGGFPHVPDQAGEQRAYSPSRSSAGVSSSPLGGLAAMRLDSGSAGTAPMLRSRLPPAPSAPSGVPQVRNIEEMPAGVLQHVASFLDPRSRRALSQVSTTMNDAARSSQTHMQAWNKAMLGQLHRYPNLQSLRLRGDITLDELKALPKTLRHIDLGECDPGCGAKSHAAIEYLATLPLESLNVKGAAIGDRGAALLAGNRSLKTLNVADGGISEVGARKLADHASLESLDMTGNQIDARGAQHLATSESIQTLRLCCCGVTDPGIQALAGNRQLKSLDVSGNHINEDALRALAANPSLTTLDVSCNRQTPVGEPQSVEQGVSMALALAEGLVGRETPLASLKADGNAFVDFAVEMLAFPTIRTASLSLKSNFIGPEGAQKLAENPALKSLDLTRNKIGDAGAEALSHSRSLKTLSVLNCDVKDPGAQALARNPTLTTLDLGNLISEKQNPAARQQEQDEFDTTANEITENGTRALAQSPSLISLSVQGNLCEDAGVLPLARSPRLTSLNVAYTNMTLESARELASNPVLTSLNVRWNYEHLGTAGVLELAKSQSLTFLDARDTCMGEAGALALEANTRIKGTPDDPNFIRDSYRG ask13_arath SKP1-like protein 13 ASK13 At3g60010 F24G16.280 T2O9.1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSKMVMLLSSDGESFQVEEAVAVQSQTIAHMIEDDCVANGVPIANVTGVILSKVIEYCKKHVVSDSPTEESKDELKKWDAEFMKALEQSSTLFDVMLAANYLNIKDLLDLGCQTVADMITGKKPDEIRALLGIENDFTPEEEEEIRKENQWAFE skp1b_arath SKP1-like protein 1B SKP1-like 2 UFO-binding protein 2 ASK2 UIP2 At5g42190 MJC20.30 SKP1B protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSTVRKITLKSSDGENFEIDEAVALESQTIKHMIEDDCTDNGIPLPNVTSKILSKVIEYCKRHVEAAEKSETTADAAAATTTTTVASGSSDEDLKTWDSEFIKVDQGTLFDLILAANYLNIKGLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE ask14_arath SKP1-like protein 14 At2g03170 ASK14 T18E12.16 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSNKIVLSSSDGESFEVEEAVARKLKIVEHMIEDDCVVTEVPLQNVTGKILSIVVEYCKKHVVDEESDEFKTWDEEFMKKFDQPTVFQLLLAANYLNIKGLLDLSAQTVADRIKDKTPEEIREIFNIENDFTPEEEAAVRKENAWAFE q8xyf7_ralso RSc1801 protein protein ralso ralso Pseudomonas solanacearum MKPVAPVGQSSSAADGVRAPSADAQPGPPAPGPARPARSAAGSSLLQGLAQLLSLCQPRPARPLPQLPPDIFREIARRSDPLTVQRLRVASKPVKAAIEADMRELVIKDRAGLAGVLRAGNYPALEKLTLAGTFTDDDLRGLPASLKALDLSRCRGSITAAGIAHLSRLPLVRLNVRNKRIGAEGARLLANHPTLTSLNVSNGRIGPEGAQALAANTRLTTLNVSGNRIGVAGAKALAANQTLRSLDVSDNRIGDEGARELAACTQLTTLDANRNGIGVDGATALAASRTLTSLAIGGNEIGDAGVLALAANARLTTLNVESTGVGADGVKALAASKTLTWLRLDGNDIGNAGATALAASTSLTTLHLEHSRIGAEGAQALAANTKLTTLDLGYNDIGDAGVRALSANATLVWLSVRRNNLEDASAVSLAAGKTLTTLDISGNGIQDQGAKALAANPTLTTLDVSSNDIKNAGARALAANARLVSLDLRNNRMEESGTRALLANRTLSSLGVSLNCCGQHLIAELMAWANHNGVTMRH ask16_arath SKP1-like protein 16 At2g03190 ASK16 T18E12.14 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSNKIVLTSSDDESFEVEEAVARKLKVIAHMIDDDCADKAIPLENVTGNILALVIEYCKKHVLDDVDDSDDSTEATSENVNEEAKNELRTWDAEFMKEFDMETVMKLILAVNYLNVQDLLGLTCQTVADHMKDMSPEEVRELFNIENDYTPEEEDAIRKENAWAFEDLK ask4_arath SKP1-like protein 4 T20H2.8 At1g20140 ASK4 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAETKKMIILKSSDGESFEIEEAVAVKSQTIKHMIEDDCADNGIPLPNVTGAILAKVIEYCKKHVEAAAEAGGDKDFYGSAENDELKNWDSEFVKVDQPTLFDLILAANYLNIGGLLDLTCKAVADQMRGKTPEQMRAHFNIKNDYTPEEEAEVRNENKWAFE q8xre0_ralso-ask11-1 3148247 N/A 3148267 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3148268 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false ripg-skp1a-1 3148248 N/A 3148269 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3148270 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q8xzn8_ralso-skp1a-1 3148249 N/A 3148271 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3148269 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false ripg-ask13-1 3148250 N/A 3148270 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3148272 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q8xre0_ralso-skp1b-1 3148251 N/A 3148273 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3148268 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false ripg-skp1a-2 3148252 N/A 3148269 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3148270 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q8xre0_ralso-ask14-1 3148253 N/A 3148274 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3148268 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false ripg-skp1b-1 3148254 N/A 3148273 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress N/A 3148270 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false q8xzn8_ralso-ask13-1 3148255 N/A 3148271 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3148272 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q8xyf7_ralso-ask11-1 3148256 N/A 3148275 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3148267 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q8xyf7_ralso-skp1b-1 3148257 N/A 3148275 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3148273 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false ripg-skp1b-2 3148258 N/A 3148270 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3148273 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q8xre0_ralso-ask13-1 3148259 N/A 3148272 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3148268 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q8xre0_ralso-ask16-1 3148260 N/A 3148276 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3148268 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q8xre0_ralso-skp1a-1 3148261 N/A 3148268 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3148269 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q8xzn8_ralso-ask11-1 3148262 N/A 3148271 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3148267 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q8xyf7_ralso-ask13-1 3148263 N/A 3148275 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3148272 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q8xyf7_ralso-skp1a-1 3148264 N/A 3148275 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3148269 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q8xzn8_ralso-skp1b-1 3148265 N/A 3148271 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3148273 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q8xre0_ralso-ask4-1 3148266 N/A 3148277 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3148268 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false