DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ tang-2006-16 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Tang Y., Poustovoitov MV., Zhao K., Garfinkel M., Canutescu A., Dunbrack R., Adams PD., Marmorstein R. DIP original experiment: DIP-66552X Nature structural & molecular biology 2006 IMEx Structure of a human ASF1a-HIRA complex and insights into specificity of histone chaperone complex assembly. Tang Y., Poustovoitov MV., Zhao K., Garfinkel M., Canutescu A., Dunbrack R., Adams PD., Marmorstein R. Only protein-protein interactions imex curation tang-2006-17 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Tang Y., Poustovoitov MV., Zhao K., Garfinkel M., Canutescu A., Dunbrack R., Adams PD., Marmorstein R. DIP original experiment: DIP-66553X Nature structural & molecular biology 2006 IMEx Structure of a human ASF1a-HIRA complex and insights into specificity of histone chaperone complex assembly. Tang Y., Poustovoitov MV., Zhao K., Garfinkel M., Canutescu A., Dunbrack R., Adams PD., Marmorstein R. Only protein-protein interactions imex curation tang-2006-18 in vitro In vitro competition binding competition binding weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Tang Y., Poustovoitov MV., Zhao K., Garfinkel M., Canutescu A., Dunbrack R., Adams PD., Marmorstein R. DIP original experiment: DIP-66554X Nature structural & molecular biology 2006 IMEx Structure of a human ASF1a-HIRA complex and insights into specificity of histone chaperone complex assembly. Tang Y., Poustovoitov MV., Zhao K., Garfinkel M., Canutescu A., Dunbrack R., Adams PD., Marmorstein R. Only protein-protein interactions imex curation tang-2006-19 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Tang Y., Poustovoitov MV., Zhao K., Garfinkel M., Canutescu A., Dunbrack R., Adams PD., Marmorstein R. DIP original experiment: DIP-66555X Nature structural & molecular biology 2006 IMEx Structure of a human ASF1a-HIRA complex and insights into specificity of histone chaperone complex assembly. Tang Y., Poustovoitov MV., Zhao K., Garfinkel M., Canutescu A., Dunbrack R., Adams PD., Marmorstein R. Only protein-protein interactions imex curation tang-2006-20 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Tang Y., Poustovoitov MV., Zhao K., Garfinkel M., Canutescu A., Dunbrack R., Adams PD., Marmorstein R. DIP original experiment: DIP-66556X Nature structural & molecular biology 2006 IMEx Structure of a human ASF1a-HIRA complex and insights into specificity of histone chaperone complex assembly. Tang Y., Poustovoitov MV., Zhao K., Garfinkel M., Canutescu A., Dunbrack R., Adams PD., Marmorstein R. Only protein-protein interactions imex curation tang-2006-21 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Tang Y., Poustovoitov MV., Zhao K., Garfinkel M., Canutescu A., Dunbrack R., Adams PD., Marmorstein R. DIP original experiment: DIP-66557X Nature structural & molecular biology 2006 IMEx Structure of a human ASF1a-HIRA complex and insights into specificity of histone chaperone complex assembly. Tang Y., Poustovoitov MV., Zhao K., Garfinkel M., Canutescu A., Dunbrack R., Adams PD., Marmorstein R. Only protein-protein interactions imex curation tang-2006-22 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Tang Y., Poustovoitov MV., Zhao K., Garfinkel M., Canutescu A., Dunbrack R., Adams PD., Marmorstein R. DIP original experiment: DIP-66558X Nature structural & molecular biology 2006 IMEx Structure of a human ASF1a-HIRA complex and insights into specificity of histone chaperone complex assembly. Tang Y., Poustovoitov MV., Zhao K., Garfinkel M., Canutescu A., Dunbrack R., Adams PD., Marmorstein R. Only protein-protein interactions imex curation tang-2006-23 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Tang Y., Poustovoitov MV., Zhao K., Garfinkel M., Canutescu A., Dunbrack R., Adams PD., Marmorstein R. DIP original experiment: DIP-66559X Nature structural & molecular biology 2006 IMEx Structure of a human ASF1a-HIRA complex and insights into specificity of histone chaperone complex assembly. Tang Y., Poustovoitov MV., Zhao K., Garfinkel M., Canutescu A., Dunbrack R., Adams PD., Marmorstein R. Only protein-protein interactions imex curation tang-2006-24 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Tang Y., Poustovoitov MV., Zhao K., Garfinkel M., Canutescu A., Dunbrack R., Adams PD., Marmorstein R. DIP original experiment: DIP-66562X Nature structural & molecular biology 2006 IMEx Structure of a human ASF1a-HIRA complex and insights into specificity of histone chaperone complex assembly. Tang Y., Poustovoitov MV., Zhao K., Garfinkel M., Canutescu A., Dunbrack R., Adams PD., Marmorstein R. Only protein-protein interactions imex curation tang-2006-25 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Tang Y., Poustovoitov MV., Zhao K., Garfinkel M., Canutescu A., Dunbrack R., Adams PD., Marmorstein R. DIP original experiment: DIP-66564X Nature structural & molecular biology 2006 IMEx Structure of a human ASF1a-HIRA complex and insights into specificity of histone chaperone complex assembly. Tang Y., Poustovoitov MV., Zhao K., Garfinkel M., Canutescu A., Dunbrack R., Adams PD., Marmorstein R. Only protein-protein interactions imex curation tang-2006-26 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Tang Y., Poustovoitov MV., Zhao K., Garfinkel M., Canutescu A., Dunbrack R., Adams PD., Marmorstein R. DIP original experiment: DIP-66560X Nature structural & molecular biology 2006 IMEx Structure of a human ASF1a-HIRA complex and insights into specificity of histone chaperone complex assembly. Tang Y., Poustovoitov MV., Zhao K., Garfinkel M., Canutescu A., Dunbrack R., Adams PD., Marmorstein R. Only protein-protein interactions imex curation tang-2006-27 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Tang Y., Poustovoitov MV., Zhao K., Garfinkel M., Canutescu A., Dunbrack R., Adams PD., Marmorstein R. DIP original experiment: DIP-66561X Nature structural & molecular biology 2006 IMEx Structure of a human ASF1a-HIRA complex and insights into specificity of histone chaperone complex assembly. Tang Y., Poustovoitov MV., Zhao K., Garfinkel M., Canutescu A., Dunbrack R., Adams PD., Marmorstein R. Only protein-protein interactions imex curation tang-2006-28 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Tang Y., Poustovoitov MV., Zhao K., Garfinkel M., Canutescu A., Dunbrack R., Adams PD., Marmorstein R. DIP original experiment: DIP-66563X Nature structural & molecular biology 2006 IMEx Structure of a human ASF1a-HIRA complex and insights into specificity of histone chaperone complex assembly. Tang Y., Poustovoitov MV., Zhao K., Garfinkel M., Canutescu A., Dunbrack R., Adams PD., Marmorstein R. Only protein-protein interactions imex curation asf1a_human Histone chaperone ASF1A Anti-silencing function protein 1 homolog A CCG1-interacting factor A ASF1A CGI-98 HSPC146 protein protein human Homo sapiens Human MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFHINWEDNTEKLEDAESSNPNLQSLLSTDALPSASKGWSTSENSLNVMLESHMDCM This sequence has been withdrawn from Uniprot. hira_human Protein HIRA HIRA TUP1-like enhancer of split protein 1 DGCR1 HIR TUPLE1 protein protein human Homo sapiens Human MKLLKPTWVNHNGKPIFSVDIHPDGTKFATGGQGQDSGKVVIWNMSPVLQEDDEKDENIPKMLCQMDNHLACVNCVRWSNSGMYLASGGDDKLIMVWKRATYIGPSTVFGSSGKLANVEQWRCVSILRNHSGDVMDVAWSPHDAWLASCSVDNTVVIWNAVKFPEILATLRGHSGLVKGLTWDPVGKYIASQADDRSLKVWRTLDWQLETSITKPFDECGGTTHVLRLSWSPDGHYLVSAHAMNNSGPTAQIIEREGWKTNMDFVGHRKAVTVVKFNPKIFKKKQKNGSSAKPSCPYCCCAVGSKDRSLSVWLTCLKRPLVVIHELFDKSIMDISWTLNGLGILVCSMDGSVAFLDFSQDELGDPLSEEEKSRIHQSTYGKSLAIMTEAQLSTAVIENPEMLKYQRRQQQQQLDQKSAATREMGSATSVAGVVNGESLEDIRKNLLKKQVETRTADGRRRITPLCIAQLDTGDFSTAFFNSIPLSGSLAGTMLSSHSSPQLLPLDSSTPNSFGASKPCTEPVVAASARPAGDSVNKDSMNATSTPAALSPSVLTTPSKIEPMKAFDSRFTERSKATPGAPALTSMTPTAVERLKEQNLVKELRPRDLLESSSDSDEKVPLAKASSLSKRKLELEVETVEKKKKGRPRKDSRLMPVSLSVQSPAALTAEKEAMCLSAPALALKLPIPSPQRAFTLQVSSDPSMYIEVENEVTVVGGVKLSRLKCNREGKEWETVLTSRILTAAGSCDVVCVACEKRMLSVFSTCGRRLLSPILLPSPISTLHCTGSYVMALTAAATLSVWDVHRQVVVVKEESLHSILAGSDMTVSQILLTQHGIPVMNLSDGKAYCFNPSLSTWNLVSDKQDSLAQCADFRSSLPSQDAMLCSGPLAIIQGRTSNSGRQAARLFSVPHVVQQETTLAYLENQVAAALTLQSSHEYRHWLLVYARYLVNEGFEYRLREICKDLLGPVHYSTGSQWESTVVGLRKRELLKELLPVIGQNLRFQRLFTECQEQLDILRDK asf1b_human Histone chaperone ASF1B Anti-silencing function protein 1 homolog B CCG1-interacting factor A-II ASF1B protein protein human Homo sapiens Human MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFHINWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMDCI This sequence has been withdrawn from Uniprot. caf1b_human Chromatin assembly factor 1 subunit B Chromatin assembly factor I p60 subunit M-phase phosphoprotein 7 CHAF1B CAF1A CAF1P60 MPHOSPH7 MPP7 protein protein human Homo sapiens Human MKVITCEIAWHNKEPVYSLDFQHGTAGRIHRLASAGVDTNVRIWKVEKGPDGKAIVEFLSNLARHTKAVNVVRFSPTGEILASGGDDAVILLWKVNDNKEPEQIAFQDEDEAQLNKENWTVVKTLRGHLEDVYDICWATDGNLMASASVDNTAIIWDVSKGQKISIFNEHKSYVQGVTWDPLGQYVATLSCDRVLRVYSIQKKRVAFNVSKMLSGIGAEGEARSYRMFHDDSMKSFFRRLSFTPDGSLLLTPAGCVESGENVMNTTYVFSRKNLKRPIAHLPCPGKATLAVRCCPVYFELRPVVETGVELMSLPYRLVFAVASEDSVLLYDTQQSFPFGYVSNIHYHTLSDISWSSDGAFLAISSTDGYCSFVTFEKDELGIPLKEKPVLNMRTPDTAKKTKSQTHRGSSPGPRPVEGTPASRTQDPSSPGTTPPQARQAPAPTVIRDPPSITPAVKSPLPGPSEEKTLQPSSQNTKAHPSRRVTLNTLQAWSKTTPRRINLTPLKTDTPPSSVPTSVISTPSTEEIQSETPGDAQGSPPELKRPRLDENKGGTESLDP cac2_yeast Chromatin assembly factor 1 subunit p60 CAC2 CAF-1 60 kDa subunit YML102W protein protein yeast Saccharomyces cerevisiae Baker's yeast MEASHLQIYWHDSQPVYSLTFQKNSANDKLFTAGGDNKVRIWKLNRDENGQNGGVRKIESLDFLGSLTHHEQAINVIRFNSKGDVLASAGDDGQVLLWKQEDPNTQQESVVRPFGMDAETSEADENKEKWVVWKRLRGGSGATAAAEIYDLAWSPDNRNIVVACMDNSIRLFDVGAGMLVCGQSDHGHYVQGVAWDPLNQFILSQSADRSLHVYGVILSSAGVVTGLKLRSKIAKAELPCPGDVLRTNYLFHNETLPSFFRRCSISPCGGLVVIPSGVYKVAGDEVANCVYVYTRSGILNSAGGVKNRPAIRIPSLKKPALMAAFSPVFYETCQKSVLKLPYKLVFAIATTNEVLVYDTDVLEPLCVVGNIHYSPITDLAWSEDGSTLLISSTDGFCSYVSIDTETQFGSRIEPPAMHAEPLDTDESAVAAKNQREAGGIVNMLPVKKIPCNSSDSKKRRIHPTPVDL F24853C4AA4D97C2 hira-asf1a-6 3147983 N/A 3147996 unspecified role unspecified role prey prey Q9Y294:p.Asp37Ala D37A mutation mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3147997 unspecified role unspecified role bait bait 421-432/449-729 binding region 421-432/449-729 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false 421-468/476-729 binding region 421-468/476-729 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false 421-729 binding region 421-729 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false P54198:p.Arg460Ala R460A mutation mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P54198:p.Arg459Ala R459A mutation mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P54198:p.Ile461Asp I461D mutation mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P54198:p.Leu464Asp L464D mutation mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P54198:p.Ile466Asp L466D mutation mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P54198:p.[Leu464Asp;Ile466Asp] L464D/L466D mutation mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false hira-asf1a-7 3147984 N/A 3147996 unspecified role unspecified role prey prey in vitro In vitro N/A 3147997 unspecified role unspecified role bait bait 470-479 binding region 470-479 binding region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false 421-499 binding region 421-499 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false GFP Tag GFP Tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro direct interaction direct interaction false false false asf1a-hira-2 3147985 N/A 3147996 unspecified role unspecified role neutral component neutral component in vitro In vitro N/A 3147997 unspecified role unspecified role neutral component neutral component 453-467 binding region 453-467 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false asf1a-hira-3 3147986 N/A 3147996 unspecified role unspecified role neutral component neutral component 1-157 binding region 1-157 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3147997 unspecified role unspecified role neutral component neutral component 425-472 binding region 425-472 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false asf1a-hira-4 3147987 N/A 3147996 unspecified role unspecified role unspecified role unspecified role 1-154 binding region 1-154 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3147997 unspecified role unspecified role unspecified role unspecified role 453-467 binding region 453-467 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false asf1b-hira-1 3147988 N/A 3147998 unspecified role unspecified role neutral component neutral component 1-154 binding region 1-154 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3147997 unspecified role unspecified role neutral component neutral component 453-467 binding region 453-467 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false hira-asf1b-1 3147989 N/A 3147998 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3147997 unspecified role unspecified role bait bait 421-729 binding region 421-729 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false HA Tag HA Tag experimental feature experimental feature predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false hira-asf1a-8 3147990 N/A 3147996 unspecified role unspecified role prey prey 1-154 binding region 1-154 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false Q9Y294:p.Asp37Ala D37A mutation mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3147997 unspecified role unspecified role bait bait 425-472 binding region 425-472 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false GST Tag GST Tag experimental feature experimental feature predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P54198:p.Arg458_Arg460delinsAlaLysLys 458-460 AKK mutation mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false chaf1b-asf1a-1 3147991 N/A 3147999 unspecified role unspecified role bait bait 376-559 binding region 376-559 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false 482-496 binding region 482-496 binding region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q13112:p.[Arg483Ala;Arg499Ala] R483A/R499A mutation mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3147996 unspecified role unspecified role prey prey 1-154 binding region 1-154 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false Q9Y294:p.Asp37Ala D37A mutation mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false cac2p-asf1a-1 3147992 N/A 3148000 unspecified role unspecified role bait bait 402-468 binding region 402-468 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false 457-468 binding region 457-468 binding region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3147996 unspecified role unspecified role prey prey 1-154 binding region 1-154 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false asf1a-chaf1b-1 3147993 N/A 3147999 unspecified role unspecified role prey prey HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human N/A 3147996 unspecified role unspecified role bait bait Myc Tag Myc Tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false hira-asf1b-2 3147994 N/A 3147998 unspecified role unspecified role prey prey 1-154 binding region 1-154 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3147997 unspecified role unspecified role bait bait 425-472 binding region 425-472 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false chaf1b-asf1b-1 3147995 N/A 3147999 unspecified role unspecified role bait bait 376-559 binding region 376-559 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3147998 unspecified role unspecified role prey prey 1-154 binding region 1-154 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false