DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ larivire-2006-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down predetermined predetermined participant predetermined Larivière L., Geiger S., Hoeppner S., Röther S., Strässer K., Cramer P. DIP original experiment: DIP-66543X Nature structural & molecular biology 2006 IMEx Structure and TBP binding of the Mediator head subcomplex Med8-Med18-Med20. Larivière L., Geiger S., Hoeppner S., Röther S., Strässer K., Cramer P. Only protein-protein interactions imex curation larivire-2006-2 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Larivière L., Geiger S., Hoeppner S., Röther S., Strässer K., Cramer P. DIP original experiment: DIP-66544X Nature structural & molecular biology 2006 IMEx Structure and TBP binding of the Mediator head subcomplex Med8-Med18-Med20. Larivière L., Geiger S., Hoeppner S., Röther S., Strässer K., Cramer P. Only protein-protein interactions imex curation larivire-2006-3 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Larivière L., Geiger S., Hoeppner S., Röther S., Strässer K., Cramer P. DIP original experiment: DIP-66545X Nature structural & molecular biology 2006 IMEx Structure and TBP binding of the Mediator head subcomplex Med8-Med18-Med20. Larivière L., Geiger S., Hoeppner S., Röther S., Strässer K., Cramer P. Only protein-protein interactions imex curation larivire-2006-4 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Larivière L., Geiger S., Hoeppner S., Röther S., Strässer K., Cramer P. DIP original experiment: DIP-66546X Nature structural & molecular biology 2006 IMEx Structure and TBP binding of the Mediator head subcomplex Med8-Med18-Med20. Larivière L., Geiger S., Hoeppner S., Röther S., Strässer K., Cramer P. Only protein-protein interactions imex curation larivire-2006-5 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Larivière L., Geiger S., Hoeppner S., Röther S., Strässer K., Cramer P. DIP original experiment: DIP-66547X Nature structural & molecular biology 2006 IMEx Structure and TBP binding of the Mediator head subcomplex Med8-Med18-Med20. Larivière L., Geiger S., Hoeppner S., Röther S., Strässer K., Cramer P. Only protein-protein interactions imex curation larivire-2006-6 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Larivière L., Geiger S., Hoeppner S., Röther S., Strässer K., Cramer P. DIP original experiment: DIP-66548X Nature structural & molecular biology 2006 IMEx Structure and TBP binding of the Mediator head subcomplex Med8-Med18-Med20. Larivière L., Geiger S., Hoeppner S., Röther S., Strässer K., Cramer P. Only protein-protein interactions imex curation larivire-2006-7 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Larivière L., Geiger S., Hoeppner S., Röther S., Strässer K., Cramer P. DIP original experiment: DIP-66549X Nature structural & molecular biology 2006 IMEx Structure and TBP binding of the Mediator head subcomplex Med8-Med18-Med20. Larivière L., Geiger S., Hoeppner S., Röther S., Strässer K., Cramer P. Only protein-protein interactions imex curation larivire-2006-8 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Larivière L., Geiger S., Hoeppner S., Röther S., Strässer K., Cramer P. DIP original experiment: DIP-66542X Nature structural & molecular biology 2006 IMEx Structure and TBP binding of the Mediator head subcomplex Med8-Med18-Med20. Larivière L., Geiger S., Hoeppner S., Röther S., Strässer K., Cramer P. Only protein-protein interactions imex curation med20_yeast Mediator of RNA polymerase II transcription subunit 20 YHR041C SRB2 HRS2 MED20 Mediator complex subunit 20 Suppressor of RNA polymerase B 2 Hyper-recombination suppressor protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MGKSAVIFVERATPATLTELKDALSNSILSVRDPWSIDFRTYRCSIKNLPADVSKLMYSITFHHHGRQTVLIKDNSAMVTTAAAADIPPALVFNGSSTGVPESIDTILSSKLSNIWMQRQLIKGDAGETLILDGLTVRLVNLFSSTGFKGLLIELQADEAGEFETKIAGIEGHLAEIRAKEYKTSSDSLGPDTSNEICDLAYQYVRALEL C30BF309D43AFB2A med18_yeast Mediator of RNA polymerase II transcription subunit 18 YGR104C SRB5 MED18 Mediator complex subunit 18 Suppressor of RNA polymerase B 5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVQQLSLFGSIGDDGYDLLISTLTTISGNPPLLYNSLCTVWKPNPSYDVENVNSRNQLVEPNRIKLSKEVPFSYLIDETMMDKPLNFRILKSFTNDKIPLNYAMTRNILHNTVPQVTNFNSTNEDQNNSKHTEDTVNESRNSDDIIDVDMDASPAPSNESCSPWSLQISDIPAAGNNRSVSMQTIAETIILSSAGKNSSVSSLMNGLGYVFEFQYLTIGVKFFMKHGLILELQKIWQIEEAGNSQITSGGFLLKAYINVSRGTDIDRINYTETALMNLKKELQGYIELSVPDRQSMDSRVAHGNILI B1148FC187C2802A med8_yeast Mediator of RNA polymerase II transcription subunit 8 YBR193C YBR1403 MED8 Mediator complex subunit 8 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSQSTASLVPEGNQGSLQEDVSFDFNGVPGQALDAVRMRLAQLTHSLRRIRDEMSKAELPQWYTLQSQLNVTLSQLVSVTSTLQHFQETLDSTVVYPLPKFPTTSHESLVTTLLRKKNIPEVDEWMKYVRETSGVTTALLKDEEIEKLLQQDREITNWARTTFRNEYGKHDFKNEESLSEEHASLLVRDSKPSKPFNVDDVLKFTFTGEKPIITGSTSTSSSN 86B2A064293C6B61 tbp_yeast TATA-box-binding protein YER148W SPT15 BTF1 TBP1 TATA-box factor TATA-binding factor TATA sequence-binding protein Transcription factor D Transcription initiation factor TFIID TBP subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAAPESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM 50365FFF1D3718CE rpb4_yeast DNA-directed RNA polymerase II subunit RPB4 RPB4 YJL140W J0654 DNA-directed RNA polymerase II 32 kDa polypeptide B32 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNVSTSTFQTRRRRLKKVEEEENAATLQLGQEFQLKQINHQGEEEELIALNLSEARLVIKEALVERRRAFKRSQKKHKKKHLKHENANDETTAVEDEDDDLDEDDVNADDDDFMHSETREKELESIDVLLEQTTGGNNKDLKNTMQYLTNFSRFRDQETVGAVIQLLKSTGLHPFEVAQLGSLACDTADEAKTLIPSLNNKISDDELERILKELSNLETLY 72A8A26871B87775 rpb7_yeast DNA-directed RNA polymerase II subunit RPB7 RPB7 YDR404C D9509.22 B16 protein protein yeast Saccharomyces cerevisiae Baker's yeast MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI 44C85603A93CDE67 med18-med20-6 3147768 N/A 3147776 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3147777 unspecified role unspecified role bait bait 1-108/141-307 binding region 1-108/141-307 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false His Tag His Tag experimental feature experimental feature predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli direct interaction direct interaction false false false med8-med18-1 3147769 N/A 3147776 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3147777 unspecified role unspecified role prey prey 1-108/141-307 binding region 1-108/141-307 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3147778 unspecified role unspecified role bait bait 190-210 binding region 190-210 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false His Tag His Tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli association association false false false med18-med20-7 3147770 N/A 3147776 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli N/A 3147777 unspecified role unspecified role neutral component neutral component 1-108/141-307 binding region 1-108/141-307 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3147778 unspecified role unspecified role neutral component neutral component 190-210 binding region 190-210 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false His Tag His Tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli physical association physical association false false false tbp-med18-1 3147771 N/A 3147779 unspecified role unspecified role bait bait His Tag His Tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3147776 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3147777 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3147778 unspecified role unspecified role prey prey ecolx Escherichia coli association association false false false tbp-med8-1 3147772 N/A 3147779 unspecified role unspecified role bait bait His Tag His Tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3147778 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false tbp-med8-2 3147773 N/A 3147779 unspecified role unspecified role bait bait His Tag His Tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3147778 unspecified role unspecified role prey prey 1-138 binding region 1-138 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false rpb7-rpb4-1 3147774 N/A 3147780 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3147781 unspecified role unspecified role bait bait His Tag His Tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli direct interaction direct interaction false false false med18-med20-8 3147775 N/A 3147776 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli N/A 3147777 unspecified role unspecified role neutral component neutral component 1-108/141-307 binding region 1-108/141-307 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false