IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ eissmann-2006-2 human-nkl Homo sapiens nkl nkl anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Eissmann P., Watzl C. The residue mapping of the Y2F and Y13F cytoplasmic tail mutants was deduced from the distance apart of the adenine nucleotide residues as stated in the methods;Y1 (818), Y2 (851), Y3 (923). NTB-A-negative and -positive NKL lines were generated. carsten.watzl@urz.uni-heidelberg.de Journal of immunology (Baltimore, Md. : 1950) 2006 imex curation Only protein-protein interactions eissmann-2006-1 human-nk_cells human-Natural Killer cells Human nk_cells Natural killer cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Eissmann P., Watzl C. Untreated IL-2-activated human NK cells, or a mix of primary human IL-2 activated NK cells with 721.221 cells (- which do not express either SAP or EAT-2.) carsten.watzl@urz.uni-heidelberg.de Journal of immunology (Baltimore, Md. : 1950) 2006 imex curation Only protein-protein interactions sh21a_human SH2 domain-containing protein 1A SH2D1A DSHP SAP Signaling lymphocytic activation molecule-associated protein T-cell signal transduction molecule SAP Duncan disease SH2-protein protein protein human Homo sapiens Human MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP mint Inhibitor of the SLAM self-association. Acts by blocking recruitment of the SH2-domain-containing signal-transduction molecule SHP-2 to a docking site in the slam cytoplasmic region Defects in SH2D1A are a cause of lymphoproliferative syndrome X-linked type 1 (XLP1) [MIM:308240]; also known as X-linked lymphoproliferative disease (XLPD) or Duncan disease. XLP is a rare immunodeficiency characterized by extreme susceptibility to infection with Epstein-Barr virus (EBV). Symptoms include severe or fatal mononucleosis, acquired hypogammaglobulinemia, pancytopenia and malignant lymphoma slaf6_human SLAM family member 6 KALI SLAMF6 Activating NK receptor NK-T-B-antigen UNQ6123/PRO20080 protein protein human Homo sapiens Human MLWLFQSLLFVFCFGPGNVVSQSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKMILFMVSGICIVFGFIILLLLVLRKRRDSLSLSTQRTQGPAESARNLEYVSVSPTNNTVYASVTHSNRETEIWTPRENDTITIYSTINHSKESKPTFSRATALDNVV sh21b_human SH2 domain-containing protein 1B SH2D1B EAT2 EWS/FLI1-activated transcript 2 protein protein human Homo sapiens Human MDLPYYHGRLTKQDCETLLLKEGVDGNFLLRDSESIPGVLCLCVSFKNIVYTYRIFREKHGYYRIQTAEGSPKQVFPSLKELISKFEKPNQGMVVHLLKPIKRTSPSLRWRGLKLELETFVNSNSDYVDVLP cd244_human Natural killer cell receptor 2B4 NK cell type I receptor protein 2B4 NK cell activation-inducing ligand CD244 2B4 SLAM family member 4 Signaling lymphocytic activation molecule 4 protein protein human Homo sapiens Human MLGQVVTLILLLLLKVYQGKGCQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFESLLPDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEFRFWPFLVIIVILSALFLGTLACFCVWRRKRKEKQSETSPKEFLTIYEDVKDLKTRRNHEQEQTFPGGGSTIYSMIQSQSSAPTSQEPAYTLYSLIQPSRKSGSRKRNHSPSFNSTIYEVIGKSQPKAQNPARLSRKELENFDVYS sh2d1a-cd244-1 2971023 N/A 2971025 unspecified role unspecified role bait bait N/A 2971026 unspecified role unspecified role prey prey N/A 2971027 unspecified role unspecified role prey prey association association false false false 5C sh2d1a-sh2d1b-2 2971023 N/A 2971026 unspecified role unspecified role bait bait Q96DU3:p.[Tyr274Phe;Tyr309Phe] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false N/A 2971027 unspecified role unspecified role prey prey physical association physical association false false false 7Ai The Y13F mutant, only containing functional Y2, coimmunoprecipitated EAT-2, but not SAP. slamf6-sh2d1a-3 2971023 N/A 2971025 unspecified role unspecified role prey prey N/A 2971026 unspecified role unspecified role bait bait Q96DU3:p.Tyr285Phe mutation mutation certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 7Aii When the second tyrosine was mutated (Y2F), the association of EAT-2 with NTB-A was lost, while SAP still associated. sh2d1a-sh2d1b-3 2971023 N/A 2971025 unspecified role unspecified role prey prey N/A 2971026 unspecified role unspecified role bait bait N/A 2971027 unspecified role unspecified role prey prey association association false false false 7A slamf6-sh2d1a-2 2971024 N/A 2971025 unspecified role unspecified role prey prey N/A 2971026 unspecified role unspecified role bait bait N/A 2971027 unspecified role unspecified role prey prey association association false false false 3A, 4A/B CHEBI:78332 -Src kinase inhibitor, PP1 sh2d1a-sh2d1b-1 2971024 N/A 2971025 unspecified role unspecified role bait bait N/A 2971028 unspecified role unspecified role prey prey N/A 2971026 unspecified role unspecified role prey prey N/A 2971027 unspecified role unspecified role prey prey association association false false false 5A IL-2-activated primary human NK cells. A very weak association with CD244 was detected.