DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ knockaert-2006-1 xenla Xenopus laevis (African clawed frog) African clawed frog anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Knockaert M., Sapkota G., Alarcón C., Massagué J., Brivanlou AH. DIP original experiment: DIP-263475X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Unique players in the BMP pathway: small C-terminal domain phosphatases dephosphorylate Smad1 to attenuate BMP signaling. Knockaert M., Sapkota G., Alarcón C., Massagué J., Brivanlou AH. Only protein-protein interactions imex curation knockaert-2006-2 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Knockaert M., Sapkota G., Alarcón C., Massagué J., Brivanlou AH. DIP original experiment: DIP-263477X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Unique players in the BMP pathway: small C-terminal domain phosphatases dephosphorylate Smad1 to attenuate BMP signaling. Knockaert M., Sapkota G., Alarcón C., Massagué J., Brivanlou AH. Only protein-protein interactions imex curation knockaert-2006-3 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Knockaert M., Sapkota G., Alarcón C., Massagué J., Brivanlou AH. DIP original experiment: DIP-263479X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Unique players in the BMP pathway: small C-terminal domain phosphatases dephosphorylate Smad1 to attenuate BMP signaling. Knockaert M., Sapkota G., Alarcón C., Massagué J., Brivanlou AH. Only protein-protein interactions imex curation knockaert-2006-4 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Knockaert M., Sapkota G., Alarcón C., Massagué J., Brivanlou AH. DIP original experiment: DIP-263481X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Unique players in the BMP pathway: small C-terminal domain phosphatases dephosphorylate Smad1 to attenuate BMP signaling. Knockaert M., Sapkota G., Alarcón C., Massagué J., Brivanlou AH. Only protein-protein interactions imex curation knockaert-2006-5 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Knockaert M., Sapkota G., Alarcón C., Massagué J., Brivanlou AH. DIP original experiment: DIP-263482X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Unique players in the BMP pathway: small C-terminal domain phosphatases dephosphorylate Smad1 to attenuate BMP signaling. Knockaert M., Sapkota G., Alarcón C., Massagué J., Brivanlou AH. Only protein-protein interactions imex curation knockaert-2006-6 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Knockaert M., Sapkota G., Alarcón C., Massagué J., Brivanlou AH. DIP original experiment: DIP-263476X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Unique players in the BMP pathway: small C-terminal domain phosphatases dephosphorylate Smad1 to attenuate BMP signaling. Knockaert M., Sapkota G., Alarcón C., Massagué J., Brivanlou AH. Only protein-protein interactions imex curation knockaert-2006-7 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Knockaert M., Sapkota G., Alarcón C., Massagué J., Brivanlou AH. DIP original experiment: DIP-263478X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Unique players in the BMP pathway: small C-terminal domain phosphatases dephosphorylate Smad1 to attenuate BMP signaling. Knockaert M., Sapkota G., Alarcón C., Massagué J., Brivanlou AH. Only protein-protein interactions imex curation knockaert-2006-8 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Knockaert M., Sapkota G., Alarcón C., Massagué J., Brivanlou AH. DIP original experiment: DIP-263480X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Unique players in the BMP pathway: small C-terminal domain phosphatases dephosphorylate Smad1 to attenuate BMP signaling. Knockaert M., Sapkota G., Alarcón C., Massagué J., Brivanlou AH. Only protein-protein interactions imex curation knockaert-2006-9 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Knockaert M., Sapkota G., Alarcón C., Massagué J., Brivanlou AH. DIP original experiment: DIP-263483X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Unique players in the BMP pathway: small C-terminal domain phosphatases dephosphorylate Smad1 to attenuate BMP signaling. Knockaert M., Sapkota G., Alarcón C., Massagué J., Brivanlou AH. Only protein-protein interactions imex curation smad1_human Mothers against decapentaplegic homolog 1 Mad-related protein 1 SMAD family member 1 Transforming growth factor-beta-signaling protein 1 JV4-1 SMAD1 BSP1 MADH1 MADR1 protein protein human Homo sapiens Human MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMTQDGSQPMDTNMMAPPLPSEINRGDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS q8uwd4_xenla Protein-serine/threonine phosphatase ctdsp2.L MGC68415 ctdsp2 XELAEV_18013473mg protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MESSSIIAQVHREEALVHSKPGLVSKSSPKKPRSRSIFKALFCCLSAQNVSRPGGSSESPIQKEETNATPKSDLLQCLQYQFYQIPGTSLLPEVAPKDKGKICMVIDLDETLVHSSFKPISNADFIVPVEIEGTTHQVYVLKRPYVDEFLERMGQLYECVLFTASLAKYADPVTDLLDKSGVFRSRLFREACVFHQGCYVKDLSRLGRDLKKTVILDNSPASYIFHPENAVPVQSWFDDMSDTELLSLIPIFEEFSYSEDIYTSLGQLKAP ctds2_human Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2 NIF2 OS4 SCP2 Nuclear LIM interactor-interacting factor 2 Protein OS-4 Small C-terminal domain phosphatase 2 Small CTD phosphatase 2 CTDSP2 protein protein human Homo sapiens Human MEHGSIITQARREDALVLTKQGLVSKSSPKKPRGRNIFKALFCCFRAQHVGQSSSSTELAAYKEEANTIAKSDLLQCLQYQFYQIPGTCLLPEVTEEDQGRICVVIDLDETLVHSSFKPINNADFIVPIEIEGTTHQVYVLKRPYVDEFLRRMGELFECVLFTASLAKYADPVTDLLDRCGVFRARLFRESCVFHQGCYVKDLSRLGRDLRKTLILDNSPASYIFHPENAVPVQSWFDDMADTELLNLIPIFEELSGAEDVYTSLGQLRAP smad2_human Mothers against decapentaplegic homolog 2 SMAD2 MADH2 MADR2 Mad-related protein 2 SMAD family member 2 JV18-1 protein protein human Homo sapiens Human MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLVPRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVDGFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS ctds1_human Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 SCP1 Nuclear LIM interactor-interacting factor 3 CTDSP1 NIF3 NLIIF Small C-terminal domain phosphatase 1 protein protein human Homo sapiens Human MDSSAVITQISKEEARGPLRGKGDQKSAASQKPRSRGILHSLFCCVCRDDGEALPAHSGAPLLVEENGAIPKQTPVQYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLRQPRPGS ctdsl_human CTD small phosphatase-like protein CTDSPL C3orf8 Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 3 NIF-like protein NIF1 NIFL Nuclear LIM interactor-interacting factor 1 Protein YA22 RBSP3 SCP3 Small C-terminal domain phosphatase 3 YA22 protein protein human Homo sapiens Human MDGPAIITQVTNPKEDEGRLPGAGEKASQCNVSLKKQRSRSILSSFFCCFRDYNVEAPPPSSPSVLPPLVEENGGLQKGDQRQVIPIPSPPAKYLLPEVTVLDYGKKCVVIDLDETLVHSSFKPISNADFIVPVEIDGTIHQVYVLKRPHVDEFLQRMGQLFECVLFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVKDLSRLGRELSKVIIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFEGLSREDDVYSMLHRLCNR ctdsp2-smad1-1 3146489 N/A 3146498 unspecified role unspecified role prey prey xenla Xenopus laevis (African clawed frog) African clawed frog N/A 3146499 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false xenla Xenopus laevis (African clawed frog) African clawed frog physical association physical association false false false ctdsp2-smad1-2 3146490 N/A 3146500 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3146498 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false ctdsp1-smad2-1 3146491 N/A 3146501 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3146502 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false ctdsp1-smad1-1 3146492 N/A 3146498 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3146502 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false ctdsp2-smad1-3 3146493 N/A 3146500 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3146498 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false ctdsp1-smad1-2 3146494 N/A 3146498 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3146502 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false ctdspl-smad1-1 3146495 N/A 3146503 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3146498 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false ctdspl-smad2-1 3146496 N/A 3146503 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3146501 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false ctdspl-smad1-2 3146497 N/A 3146503 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3146498 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false