DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ jacob_wilk-2006-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Jacob-Wilk D., Kurek I., Hogan P., Delmer DP. DIP original experiment: DIP-263454X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The cotton fiber zinc-binding domain of cellulose synthase A1 from Gossypium hirsutum displays rapid turnover in vitro and in vivo. Jacob-Wilk D., Kurek I., Hogan P., Delmer DP. Only protein-protein interactions imex curation jacob_wilk-2006-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Jacob-Wilk D., Kurek I., Hogan P., Delmer DP. DIP original experiment: DIP-263455X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The cotton fiber zinc-binding domain of cellulose synthase A1 from Gossypium hirsutum displays rapid turnover in vitro and in vivo. Jacob-Wilk D., Kurek I., Hogan P., Delmer DP. Only protein-protein interactions imex curation jacob_wilk-2006-3 in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting western blot western blot Immuno blot Immuno blot Jacob-Wilk D., Kurek I., Hogan P., Delmer DP. DIP original experiment: DIP-263456X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The cotton fiber zinc-binding domain of cellulose synthase A1 from Gossypium hirsutum displays rapid turnover in vitro and in vivo. Jacob-Wilk D., Kurek I., Hogan P., Delmer DP. Only protein-protein interactions imex curation q1eg93_goshi Cellulose synthase CesA1 protein protein goshi Gossypium hirsutum Upland cotton Gossypium mexicanum MMESGVPVCHTCGEHVGLNVNGEPFVACHECNFPICKSCFEYDLKEGRKACLRCGSPYDENLLDDVEKATGDQSTMAAHLSKSQDVGIHARHISSVSTLDSEMTEDNGNPIWKNRVESWKEKKNKKKKPATTKVEREAEIPPEQQMEDKPAPDASQPLSTIIPIPKSRLAPYRTVIIMRLIILGLFFHYRVTNPVDSAFGLWLTSVICEIWFAFSWVLDQFPKWYPVNRETYIDRLSARYEREGEPNELAAVDFFVSTVDPLKEPPLITANTVLSILALDYPVDKVSCYISDDGAAMLTFESLVETADFARKWVPFCKKFSIEPRAPEFYFSQKIDYLKDKVQPSFVKERRAMKRDYEEYKIRINALVAKAQKTPEEGWTMQDGTPWPGNNPRDHPGMIQVFLGYSGAHDIEGNELPRLVYVSREKRPGYQHHKKAGAENALVRVSAVLTNAPFILNLDCDHYVNNSKAVREAMCFLMDPQVGRDVCYVQFPQRFDGIDRSDRYANRNTVFFDVNMKGLDGIQGPVYVGTGCVFNRQALYGYGPPSMPSFPKSSSSSCSCCCPGKKEPKDPSELYRDAKREELDAAIFNLREIDNYDEYERSMLISQTSFEKTFGLSSVFIESTLMENGGVAESANPSTLIKEAIHVIGCGYEEKTAWGKEYPFTSLPLIAYCSLPAICLLTGKFIIPTLSNLASVLFLGLFLSIIVTAVLELRWSGVSIEDLWRNEQFWVIGGVSAHLFAVFQGFLKMLAGIDTNFTVTAKAADDADFGELYIVKWTTLLIPPTTLLIVNMVGVVAGFSDALNKGYEAWGPLFGKVFFSFWVILHLYPFLKGLMGRQNRTPTIVVLWSVLLASVFSLVWVRINPFVSTADSTTVSQSCISIDC q2vwa6_goshi met-1 protein protein goshi Gossypium hirsutum Upland cotton Gossypium mexicanum MSCCGGNCGCGSGCKCGGGGGCGCGGCKMYPEMNFAEQTTTETLVLGVAPRKVNFDGAEMETGAENGCKCGDNCTCNPCNCK cesa1-met_1-1 3146321 N/A 3146324 unspecified role unspecified role bait bait Region 1-66 Region 1-66 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3146325 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false cesa1-met_1-2 3146322 N/A 3146324 unspecified role unspecified role bait bait Region 1-66 Region 1-66 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3146325 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false met_1-cesa1-1 3146323 N/A 3146324 unspecified role unspecified role prey prey Region 1-66 Region 1-66 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3146325 unspecified role unspecified role bait bait ecolx Escherichia coli direct interaction direct interaction false false false