DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ wang-2006-20 trini Trichoplusia ni (Cabbage looper) Cabbage looper x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wang X., Baloh RH., Milbrandt J., Garcia KC. DIP original experiment: DIP-66312X Structure (London, England : 1993) 2006 IMEx Structure of artemin complexed with its receptor GFRalpha3: convergent recognition of glial cell line-derived neurotrophic factors. Wang X., Baloh RH., Milbrandt J., Garcia KC. Only protein-protein interactions imex curation wang-2006-21 trini Trichoplusia ni (Cabbage looper) Cabbage looper x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wang X., Baloh RH., Milbrandt J., Garcia KC. DIP original experiment: DIP-66313X Structure (London, England : 1993) 2006 IMEx Structure of artemin complexed with its receptor GFRalpha3: convergent recognition of glial cell line-derived neurotrophic factors. Wang X., Baloh RH., Milbrandt J., Garcia KC. Only protein-protein interactions imex curation wang-2006-22 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Wang X., Baloh RH., Milbrandt J., Garcia KC. DIP original experiment: DIP-66314X Structure (London, England : 1993) 2006 IMEx Structure of artemin complexed with its receptor GFRalpha3: convergent recognition of glial cell line-derived neurotrophic factors. Wang X., Baloh RH., Milbrandt J., Garcia KC. Only protein-protein interactions imex curation wang-2006-23 trini Trichoplusia ni (Cabbage looper) Cabbage looper light scattering light scattering predetermined predetermined participant predetermined Wang X., Baloh RH., Milbrandt J., Garcia KC. DIP original experiment: DIP-66315X Structure (London, England : 1993) 2006 IMEx Structure of artemin complexed with its receptor GFRalpha3: convergent recognition of glial cell line-derived neurotrophic factors. Wang X., Baloh RH., Milbrandt J., Garcia KC. Only protein-protein interactions imex curation wang-2006-24 trini Trichoplusia ni (Cabbage looper) Cabbage looper molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Wang X., Baloh RH., Milbrandt J., Garcia KC. DIP original experiment: DIP-66316X Structure (London, England : 1993) 2006 IMEx Structure of artemin complexed with its receptor GFRalpha3: convergent recognition of glial cell line-derived neurotrophic factors. Wang X., Baloh RH., Milbrandt J., Garcia KC. Only protein-protein interactions imex curation artn_human Artemin ARTN EVN Enovin Neublastin protein protein human Homo sapiens Human MELGLGGLSTLSHCPWPRQQPALWPTLAALALLSSVAEASLGSAPRSPAPREGPPPVLASPAGHLPGGRTARWCSGRARRPPPQPSRPAPPPPAPPSALPRGGRAARAGGPGSRARAAGARGCRLRSQLVPVRALGLGHRSDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPGSRPVSQPCCRPTRYEAVSFMDVNSTWRTVDRLSATACGCLG gfra3_human GDNF family receptor alpha-3 GFRA3 UNQ339/PRO538/PRO3664 protein protein human Homo sapiens Human MVRPLNPRPLPPVVLMLLLLLPPSPLPLAAGDPLPTESRLMNSCLQARRKCQADPTCSAAYHHLDSCTSSISTPLPSEEPSVPADCLEAAQQLRNSSLIGCMCHRRMKNQVACLDIYWTVHRARSLGNYELDVSPYEDTVTSKPWKMNLSKLNMLKPDSDLCLKFAMLCTLNDKCDRLRKAYGEACSGPHCQRHVCLRQLLTFFEKAAEPHAQGLLLCPCAPNDRGCGERRRNTIAPNCALPPVAPNCLELRRLCFSDPLCRSRLVDFQTHCHPMDILGTCATEQSRCLRAYLGLIGTAMTPNFVSNVNTSVALSCTCRGSGNLQEECEMLEGFFSHNPCLTEAIAAKMRFHSQLFSQDWPHPTFAVMAHQNENPAVRPQPWVPSLFSCTLPLILLLSLW artn-1 3144749 N/A 3144754 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false artn-gfra3-1 3144750 N/A 3144755 unspecified role unspecified role unspecified role unspecified role Region 32-363 Region 32-363 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3144754 unspecified role unspecified role unspecified role unspecified role region 139-237 region 139-237 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false artn-gfra3-2 3144751 N/A 3144755 unspecified role unspecified role unspecified role unspecified role Region 32-363 Region 32-363 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3144754 unspecified role unspecified role unspecified role unspecified role region 139-237 region 139-237 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false artn-gfra3-3 3144752 N/A 3144755 unspecified role unspecified role unspecified role unspecified role Region 32-363 Region 32-363 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3144754 unspecified role unspecified role unspecified role unspecified role region 139-237 region 139-237 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false artn-gfra3-4 3144753 N/A 3144755 unspecified role unspecified role unspecified role unspecified role Region 32-363 Region 32-363 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3144754 unspecified role unspecified role unspecified role unspecified role region 139-237 region 139-237 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false