DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ lacal-2006-1 in vitro In vitro phosphotransferase phosphotransferase assay phosphotransferase weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Lacal J., Busch A., Guazzaroni ME., Krell T., Ramos JL. DIP original experiment: DIP-263154X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The TodS-TodT two-component regulatory system recognizes a wide range of effectors and works with DNA-bending proteins. Lacal J., Busch A., Guazzaroni ME., Krell T., Ramos JL. Only protein-protein interactions imex curation lacal-2006-2 in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Lacal J., Busch A., Guazzaroni ME., Krell T., Ramos JL. DIP original experiment: DIP-263155X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The TodS-TodT two-component regulatory system recognizes a wide range of effectors and works with DNA-bending proteins. Lacal J., Busch A., Guazzaroni ME., Krell T., Ramos JL. Only protein-protein interactions imex curation lacal-2006-3 in vitro In vitro phosphatase assay phosphatase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Lacal J., Busch A., Guazzaroni ME., Krell T., Ramos JL. DIP original experiment: DIP-263156X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The TodS-TodT two-component regulatory system recognizes a wide range of effectors and works with DNA-bending proteins. Lacal J., Busch A., Guazzaroni ME., Krell T., Ramos JL. Only protein-protein interactions imex curation todt_psept Response regulator protein TodT todT tobT T1E_4277 protein protein psept Pseudomonas putida (strain DOT-T1E) MPARWGCLFPGKYPCQTGLRHMSDRASVIYILDDDNAVLEALSSLVRSIGLSVECFSSASVFLNDVNRSACGCLILDVRMPEMSGLDVQRQLKELGEQIPIIFISGHGDIPMAVKAIKAGAVDFFTKPFREEELLGAIRAALKLAPQQRSNAPRVSELKENYESLSKREQQVLKFVLRGYLNKQTALELDISEATVKVHRHNIMRKMKVSSIQDLVRVTERLKDSLE tods_psept Sensor histidine kinase TodS todS dhkD T1E_4275/T1E_4276 protein protein psept Pseudomonas putida (strain DOT-T1E) MSSLDRKKPQNRSKNNYYNICLKEKGSEELTCEEHARIIFDGLYEFVGLLDAHGNVLEVNQVALEGAGITLEEIRGKPFWKARWWQISKKTEATQKRLVETASSGEFVRCDVEILGKSGGREVIAVDFSLLPICNEEGSIVYLLAEGRNITDKKKAEAMLALKNQELEQSVERIRKLDNAKSDFFAKVSHELRTPLSLILGPLEAVMAAEAGRESPYWKQFEVIQRNAMTLLKQVNTLLDLAKMDARQMGLSYRRANLSQLTRTISSNFEGIAQQKSITFDTKLPVQMVAEVDCEKYERIILNLLSNAFKFTPDGGLIRCCLSLSRPNYALVTVSDSGPGIPPALRKEIFERFHQLSQEGQQATRGTGLGLSIVKEFVELHRGTISVSDAPGGGALFQVKLPLNAPEGAYVASNTAPRRDNPQVVDTDEYLLLAPNAENEAEVLPFQSDQPRVLIVEDNPDMRGFIKDCLSSDYQVYVAPDGAKALELMSNMPPDLLITDLMMPVMSGDMLVHQVRKKNELSHIPIMVLSAKSDAELRVKLLSESVQDFLLKPFSAHELRARVSNLVSMKVAGDALRKELSDQGDDIAILTHRLIKSRHRLQQSNIALSASEARWKAVYENSAAGIVLTDPENRILNANPAFQRITGYGEKDLEGLSMEQLTPSDESPQIKQRLANLLQGGGAEYSVERSYLCKNGSTIWANASVSLMPQRVGESPVILQIIDDITEKKQAQENLNQLQQQLVYVSRSATMGEFAAYIAHEINQPLSAIMTNANAGTRWLGNEPSNIPEAKEALARIIRDSDRAAEIIRMVRSFLKRQETVLKPIDLKALVTDTSLILKAPSQNNSVNLDVVADDELPEIWGDGVQIQQLIINLAMNAIEAISQADCETRQLTLSFSGNDTGDALVISVKDTGPGISERQMAQLFNAFYTTKKEGLGMGLAICLTITEVHNGKIWVECPPAGGACFLVSIPARQGSGT tods-todt-1 3144215 N/A 3144218 phosphate acceptor phosphate acceptor unspecified role unspecified role ecolx Escherichia coli N/A 3144219 phosphate donor phosphate donor unspecified role unspecified role ecolx Escherichia coli phosphotransfer phosphotransfer reaction phosphotransfer false false false tods-1 3144216 N/A 3144219 putative self putative self unspecified role unspecified role ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation false false false tods-2 3144217 N/A 3144219 putative self putative self unspecified role unspecified role ecolx Escherichia coli dephosphorylation dephosphorylation reaction dephosphorylation false false false