DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ heddle-2006-1 ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Heddle JG., Yokoyama T., Yamashita I., Park SY., Tame JR. DIP original experiment: DIP-66291X Structure (London, England : 1993) 2006 IMEx Rounding up: Engineering 12-membered rings from the cyclic 11-mer TRAP. Heddle JG., Yokoyama T., Yamashita I., Park SY., Tame JR. Only protein-protein interactions imex curation heddle-2006-2 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Heddle JG., Yokoyama T., Yamashita I., Park SY., Tame JR. DIP original experiment: DIP-66292X Structure (London, England : 1993) 2006 IMEx Rounding up: Engineering 12-membered rings from the cyclic 11-mer TRAP. Heddle JG., Yokoyama T., Yamashita I., Park SY., Tame JR. Only protein-protein interactions imex curation mtrb_geose Transcription attenuation protein MtrB mtrB Trp RNA-binding attenuation protein Tryptophan RNA-binding attenuator protein protein protein geose Geobacillus stearothermophilus Geobacillus stearothermophilus Bacillus stearothermophilus MYTNSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEGKK mtrb-1 3144184 N/A 3144186 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false mtrb-2 3144185 N/A 3144186 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false