DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ allendorph-2006-1 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Allendorph GP., Vale WW., Choe S. DIP original experiment: DIP-262909X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structure of the ternary signaling complex of a TGF-beta superfamily member. Allendorph GP., Vale WW., Choe S. Only protein-protein interactions imex curation allendorph-2006-2 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Allendorph GP., Vale WW., Choe S. DIP original experiment: DIP-262907X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structure of the ternary signaling complex of a TGF-beta superfamily member. Allendorph GP., Vale WW., Choe S. Only protein-protein interactions imex curation allendorph-2006-3 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Allendorph GP., Vale WW., Choe S. DIP original experiment: DIP-262910X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structure of the ternary signaling complex of a TGF-beta superfamily member. Allendorph GP., Vale WW., Choe S. Only protein-protein interactions imex curation allendorph-2006-4 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Allendorph GP., Vale WW., Choe S. DIP original experiment: DIP-262908X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structure of the ternary signaling complex of a TGF-beta superfamily member. Allendorph GP., Vale WW., Choe S. Only protein-protein interactions imex curation avr2a_mouse Activin receptor type-2A Acvr2a Acvr2 Activin receptor type IIA protein protein mouse Mus musculus Mouse MGAAAKLAFAVFLISCSSGAILGRSETQECLFFNANWERDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCIEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPPYYNILLYSLVPLMLIAGIVICAFWVYRHHKMAYPPVLVPTQDPGPPPPSPLLGLKPLQLLEVKARGRFGCVWKAQLLNEYVAVKIFPIQDKQSWQNEYEVYSLPGMKHENILQFIGAEKRGTSVDVDLWLITAFHEKGSLSDFLKANVVSWNELCHIAETMARGLAYLHEDIPGLKDGHKPAISHRDIKSKNVLLKNNLTACIADFGLALKFEAGKSAGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELASRCTAADGPVDEYMLPFEEEIGQHPSLEDMQEVVVHKKKRPVLRDYWQKHAGMAMLCETIEECWDHDAEARLSAGCVGERITQMQRLTNIITTEDIVTVVTMVTNVDFPPKESSL bmp2_human Bone morphogenetic protein 2 BMP2 BMP2A Bone morphogenetic protein 2A protein protein human Homo sapiens Human MVAGTRCLLALLLPQVLLGGAAGLVPELGRRKFAAASSGRPSSQPSDEVLSEFELRLLSMFGLKQRPTPSRDAVVPPYMLDLYRRHSGQPGSPAPDHRLERAASRANTVRSFHHEESLEELPETSGKTTRRFFFNLSSIPTEEFITSAELQVFREQMQDALGNNSSFHHRINIYEIIKPATANSKFPVTRLLDTRLVNQNASRWESFDVTPAVMRWTAQGHANHGFVVEVAHLEEKQGVSKRHVRISRSLHQDEHSWSQIRPLLVTFGHDGKGHPLHKREKRQAKHKQRKRLKSSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNSVNSKIPKACCVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR bmr1a_human Bone morphogenetic protein receptor type-1A ACVRLK3 ALK3 BMPR1A Serine/threonine-protein kinase receptor R5 Activin receptor-like kinase 3 protein protein human Homo sapiens Human MPQLYIYIRLLGAYLFIISRVQGQNLDSMLHGTGMKSDSDQKKSENGVTLAPEDTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPVVIGPFFDGSIRWLVLLISMAVCIIAMIIFSSCFCYKHYCKSISSRRRYNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQVGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIYGTQGKPAIAHRDLKSKNILIKKNGSCCIADLGLAVKFNSDTNEVDVPLNTRVGTKRYMAPEVLDESLNKNHFQPYIMADIYSFGLIIWEMARRCITGGIVEEYQLPYYNMVPSDPSYEDMREVVCVKRLRPIVSNRWNSDECLRAVLKLMSECWAHNPASRLTALRIKKTLAKMVESQDVKI acvr2a-bmp2-1 3143961 N/A 3143965 unspecified role unspecified role bait bait Region 20-121 Region 20-121 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false picpa Pichia pastoris (Yeast) Yeast Pichia pastoris N/A 3143966 unspecified role unspecified role prey prey Region 283-396 Region 283-396 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false bmp2-bmpr1a-10 3143962 N/A 3143967 unspecified role unspecified role unspecified role unspecified role Region 24-152 Region 24-152 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3143966 unspecified role unspecified role unspecified role unspecified role Region 283-396 Region 283-396 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false acvr2a-bmp2-2 3143963 N/A 3143967 unspecified role unspecified role unspecified role unspecified role Region 24-152 Region 24-152 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3143965 unspecified role unspecified role unspecified role unspecified role Region 20-121 Region 20-121 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false picpa Pichia pastoris (Yeast) Yeast Pichia pastoris N/A 3143966 unspecified role unspecified role unspecified role unspecified role Region 283-396 Region 283-396 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false bmpr1a-bmp2-5 3143964 N/A 3143967 unspecified role unspecified role bait bait Region 24-152 Region 24-152 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3143966 unspecified role unspecified role prey prey Region 283-396 Region 283-396 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false