DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ wang-2006-16 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang Q., Du X., Meinkoth J., Hirohashi Y., Zhang H., Liu Q., Richter M., Greene MI. DIP original experiment: DIP-262867X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Characterization of Su48, a centrosome protein essential for cell division. Wang Q., Du X., Meinkoth J., Hirohashi Y., Zhang H., Liu Q., Richter M., Greene MI. Only protein-protein interactions imex curation wang-2006-17 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Wang Q., Du X., Meinkoth J., Hirohashi Y., Zhang H., Liu Q., Richter M., Greene MI. DIP original experiment: DIP-262865X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Characterization of Su48, a centrosome protein essential for cell division. Wang Q., Du X., Meinkoth J., Hirohashi Y., Zhang H., Liu Q., Richter M., Greene MI. Only protein-protein interactions imex curation wang-2006-18 in vitro In vitro pull down pull down autoradiography autoradiography Wang Q., Du X., Meinkoth J., Hirohashi Y., Zhang H., Liu Q., Richter M., Greene MI. DIP original experiment: DIP-262866X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Characterization of Su48, a centrosome protein essential for cell division. Wang Q., Du X., Meinkoth J., Hirohashi Y., Zhang H., Liu Q., Richter M., Greene MI. Only protein-protein interactions imex curation wang-2006-19 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Wang Q., Du X., Meinkoth J., Hirohashi Y., Zhang H., Liu Q., Richter M., Greene MI. DIP original experiment: DIP-262868X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Characterization of Su48, a centrosome protein essential for cell division. Wang Q., Du X., Meinkoth J., Hirohashi Y., Zhang H., Liu Q., Richter M., Greene MI. Only protein-protein interactions imex curation q70yc5-1 Protein ZNF365 DBZ DISC1-binding zinc-finger protein ZNF365 KIAA0844 Protein su48 ZNF365A protein protein human Homo sapiens Human MQQKAFEESRYPWQESFENVAVCLPLRCPRCGDHTRFRSLSSLRAHLEFSHSYEERTLLTKCSLFPSLKDTDLVTSSELLKPGKLQSSGNVVKQKPSYVNLYSISHEHSKDRKPFEVVAERPVSYVQTYTAMDLHADSLDGTRSGPGLPTSDTKASFEAHVREKFNRMVEAVDRTIEKRIDKLTKELAQKTAELLEVRAAFVQLTQKKQEVQRRERALNRQVDVAVEMIAVLRQRLTESEEELLRKEEEVVTFNHFLEAAAEKEVQGKARLQDFIENLLQRVELAEKQLEYYQSQQASGFVRDLSGHVLTDISSNRKPKCLSRGHPHSVCNHPDLKAHFHPKGRNHLKKAKDDRASMQPAKAIHEQAESSRDLCRPPKKGELLGFGRKGNIRPKMAKKKPTAIVNII znf365-znf365-1 3143637 N/A 3143641 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human N/A 3143641 unspecified role unspecified role bait bait Region 156-315 Region 156-315 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false znf365-znf365-2 3143638 N/A 3143641 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3143641 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false znf365-znf365-3 3143639 N/A 3143641 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 3143641 unspecified role unspecified role bait bait Region 156-407 Region 156-407 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli direct interaction direct interaction false false false znf365-znf365-4 3143640 N/A 3143641 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human N/A 3143641 unspecified role unspecified role prey prey Region 156-315 Region 156-315 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false