DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ house-2006-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined House CM., Hancock NC., Möller A., Cromer BA., Fedorov V., Bowtell DD., Parker MW., Polekhina G. DIP original experiment: DIP-66284X Structure (London, England : 1993) 2006 IMEx Elucidation of the substrate binding site of Siah ubiquitin ligase. House CM., Hancock NC., Möller A., Cromer BA., Fedorov V., Bowtell DD., Parker MW., Polekhina G. Only protein-protein interactions imex curation house-2006-2 in vitro In vitro pull down pull down predetermined predetermined participant predetermined House CM., Hancock NC., Möller A., Cromer BA., Fedorov V., Bowtell DD., Parker MW., Polekhina G. DIP original experiment: DIP-66285X Structure (London, England : 1993) 2006 IMEx Elucidation of the substrate binding site of Siah ubiquitin ligase. House CM., Hancock NC., Möller A., Cromer BA., Fedorov V., Bowtell DD., Parker MW., Polekhina G. Only protein-protein interactions imex curation phyl_drome Protein phyllopod phyl CG10108 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSTNQQQQANPSAAVAAPAASSEYLKRTCLICGCHTNQTINIYEPRSGPNIVQLIQAKFKFQPLNEDKFLCFSCNNWLINWHSLQAVNSNEAESQSQSPSHMGNSVLQQERTKLRPVAMVRPTVRVQPQSQPQLQPQVPINPTPAPIVYSKRRASRRSASVSRMSRVLRQCCVESLRRSPKKRNQQSVFVCLRPQGQKRSNAICKVECVAPRRKPVERLVKDVAATATPTPVLNTQSTPTYQRFPQPSVDGKVVAMFRRLGTTLSREEPAAYSAESNPACSKLPQIMSPLKEAPRWTRDLDDDEILLEFDTAISEVLPTARYQVTHEENKENQQAQEMELELEEEEEVDGRAELEVVQEAEAPLEPQSHHKQGNSHQNSHQASIQLAGLRLPMGLSISLV sia1a_mouse E3 ubiquitin-protein ligase SIAH1A Seven in absentia homolog 1a RING-type E3 ubiquitin transferase SIAH1A Siah1a protein protein mouse Mus musculus Mouse MSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLPHTEKAEHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC phyl-siah1a-1 3143516 N/A 3143518 unspecified role unspecified role unspecified role unspecified role Region 107-130 Region 107-130 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3143519 unspecified role unspecified role unspecified role unspecified role Region 92-282 Region 92-282 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false phyl-siah1a-2 3143517 N/A 3143518 unspecified role unspecified role bait bait Region 107-130 Region 107-130 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST tag GST tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro N/A 3143519 unspecified role unspecified role prey prey Region 92-282 Region 92-282 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P61092:p.Met180Lys M180K mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false P61092:p.Leu158Asp l158D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false