DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ furuyama-2006-1 drome Drosophila melanogaster (Fruit fly) Fruit fly pull down pull down de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Furuyama T., Dalal Y., Henikoff S. DIP original experiment: DIP-262846X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Chaperone-mediated assembly of centromeric chromatin in vitro. Furuyama T., Dalal Y., Henikoff S. Only protein-protein interactions imex curation furuyama-2006-2 drome Drosophila melanogaster (Fruit fly) Fruit fly tap tandem affinity purification TAP TAP tap de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Furuyama T., Dalal Y., Henikoff S. DIP original experiment: DIP-262844X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Chaperone-mediated assembly of centromeric chromatin in vitro. Furuyama T., Dalal Y., Henikoff S. Only protein-protein interactions imex curation furuyama-2006-3 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Furuyama T., Dalal Y., Henikoff S. DIP original experiment: DIP-262850X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Chaperone-mediated assembly of centromeric chromatin in vitro. Furuyama T., Dalal Y., Henikoff S. Only protein-protein interactions imex curation furuyama-2006-4 in vitro In vitro pull down pull down autoradiography autoradiography Furuyama T., Dalal Y., Henikoff S. DIP original experiment: DIP-262848X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Chaperone-mediated assembly of centromeric chromatin in vitro. Furuyama T., Dalal Y., Henikoff S. Only protein-protein interactions imex curation furuyama-2006-5 drome Drosophila melanogaster (Fruit fly) Fruit fly tap tandem affinity purification TAP TAP tap western blot western blot Immuno blot Immuno blot Furuyama T., Dalal Y., Henikoff S. DIP original experiment: DIP-262845X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Chaperone-mediated assembly of centromeric chromatin in vitro. Furuyama T., Dalal Y., Henikoff S. Only protein-protein interactions imex curation furuyama-2006-6 in vitro In vitro pull down pull down autoradiography autoradiography Furuyama T., Dalal Y., Henikoff S. DIP original experiment: DIP-262849X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Chaperone-mediated assembly of centromeric chromatin in vitro. Furuyama T., Dalal Y., Henikoff S. Only protein-protein interactions imex curation furuyama-2006-7 drome Drosophila melanogaster (Fruit fly) Fruit fly pull down pull down western blot western blot Immuno blot Immuno blot Furuyama T., Dalal Y., Henikoff S. DIP original experiment: DIP-262847X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Chaperone-mediated assembly of centromeric chromatin in vitro. Furuyama T., Dalal Y., Henikoff S. Only protein-protein interactions imex curation h4_drome Histone H4 H4 His4r H4r CG3379 His4:CG31611 CG31611 His4 His4:CG33869 His4:CG33871 His4:CG33873 His4:CG33875 His4:CG33877 His4:CG33879 His4:CG33881 His4:CG33883 His4:CG33885 His4:CG33887 His4:CG33889 His4:CG33891 His4:CG33893 His4:CG33895 His4:CG33897 His4:CG33899 His4:CG33901 His4:CG33903 His4:CG33905 His4:CG33907 His4:CG33909 CG33869 CG33871 CG33873 CG33875 CG33877 CG33879 CG33881 CG33883 CG33885 CG33887 CG33889 CG33891 CG33893 CG33895 CG33897 CG33899 CG33901 CG33903 CG33905 CG33907 CG33909 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG caf1_drome Chromatin assembly factor 1 p55 subunit Caf1-55 CAF-1 Caf1 Nucleosome-remodeling factor 55 kDa subunit CG4236 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MVDRSDNAAESFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTKQDGKDYSVHRLILGTHTSDEQNHLLIASVQLPSEDAQFDGSHYDNEKGEFGGFGSVCGKIEIEIKINHEGEVNRARYMPQNACVIATKTPSSDVLVFDYTKHPSKPEPSGECQPDLRLRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEHRVIDAKNIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWDTRNNNTSKPSHTVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSTEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAENVYNDEEPEIPASELETNTA cid_drome Histone H3-like centromeric protein cid cid CG13329 Centromere identifier protein CENP-A homolog CENP-A protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MPRHSRAKRAPRPSANNSKSPNDDDTAFRSPEPEDGTDYGLEFTTSQLTLQDNNRRSSTLRRDAGRRQPAARDSSTSGEEEDQENRYPTTRSPQTRRMTVQQESKTRAAGPVAAQNQTRRRKAANPMSRAKRMDREIRRLQHHPGTLIPKLPFSRLVREFIVKYSDDEPLRVTEGALLAMQESCEMYLTQRLADSYMLTKHRNRVTLEVRDMALMAYICDRGRQF cid-caf1-1 3143386 N/A 3143393 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3143394 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3143395 unspecified role unspecified role bait bait Biotin-tag Biotin-tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly association association false false false cid-caf1-2 3143387 N/A 3143393 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3143394 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3143395 unspecified role unspecified role bait bait TAP-tag TAP-tag tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly association association false false false caf1-cid-1 3143388 N/A 3143394 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3143395 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false cid-caf1-3 3143389 N/A 3143394 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 3143395 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false cid-caf1-4 3143390 N/A 3143394 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3143395 unspecified role unspecified role bait bait TAP-tag TAP-tag tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association false false false caf1-his4-1 3143391 N/A 3143393 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 3143394 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false cid-caf1-5 3143392 N/A 3143394 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3143395 unspecified role unspecified role bait bait Biotin-tag Biotin-tag biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false drome Drosophila melanogaster (Fruit fly) Fruit fly physical association physical association false false false