DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ hara-2006-1 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Hara MR., Thomas B., Cascio MB., Bae BI., Hester LD., Dawson VL., Dawson TM., Sawa A., Snyder SH. DIP original experiment: DIP-262653X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Neuroprotection by pharmacologic blockade of the GAPDH death cascade. Hara MR., Thomas B., Cascio MB., Bae BI., Hester LD., Dawson VL., Dawson TM., Sawa A., Snyder SH. Only protein-protein interactions imex curation g3p_human Glyceraldehyde-3-phosphate dehydrogenase GAPDH OK/SW-cl.12 CDABP0047 GAPD Peptidyl-cysteine S-nitrosylase GAPDH protein protein human Homo sapiens Human MGKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE siah1_rat E3 ubiquitin-protein ligase SIAH1 Siah1 Siah1a Seven in absentia homolog 1 Siah-1a RING-type E3 ubiquitin transferase SIAH1 protein protein rat Rattus norvegicus (Rat) Rat MSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLPHTEKAEHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC siah1-gapdh-1 3141907 N/A 3141908 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3141909 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false