DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ nowak-2006-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Nowak E., Panjikar S., Morth JP., Jordanova R., Svergun DI., Tucker PA. DIP original experiment: DIP-66129X Structure (London, England : 1993) 2006 IMEx Structural and functional aspects of the sensor histidine kinase PrrB from Mycobacterium tuberculosis. Nowak E., Panjikar S., Morth JP., Jordanova R., Svergun DI., Tucker PA. Only protein-protein interactions imex curation nowak-2006-2 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Nowak E., Panjikar S., Morth JP., Jordanova R., Svergun DI., Tucker PA. DIP original experiment: DIP-66131X Structure (London, England : 1993) 2006 IMEx Structural and functional aspects of the sensor histidine kinase PrrB from Mycobacterium tuberculosis. Nowak E., Panjikar S., Morth JP., Jordanova R., Svergun DI., Tucker PA. Only protein-protein interactions imex curation nowak-2006-3 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Nowak E., Panjikar S., Morth JP., Jordanova R., Svergun DI., Tucker PA. DIP original experiment: DIP-66133X Structure (London, England : 1993) 2006 IMEx Structural and functional aspects of the sensor histidine kinase PrrB from Mycobacterium tuberculosis. Nowak E., Panjikar S., Morth JP., Jordanova R., Svergun DI., Tucker PA. Only protein-protein interactions imex curation nowak-2006-4 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Nowak E., Panjikar S., Morth JP., Jordanova R., Svergun DI., Tucker PA. DIP original experiment: DIP-66130X Structure (London, England : 1993) 2006 IMEx Structural and functional aspects of the sensor histidine kinase PrrB from Mycobacterium tuberculosis. Nowak E., Panjikar S., Morth JP., Jordanova R., Svergun DI., Tucker PA. Only protein-protein interactions imex curation nowak-2006-5 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Nowak E., Panjikar S., Morth JP., Jordanova R., Svergun DI., Tucker PA. DIP original experiment: DIP-66132X Structure (London, England : 1993) 2006 IMEx Structural and functional aspects of the sensor histidine kinase PrrB from Mycobacterium tuberculosis. Nowak E., Panjikar S., Morth JP., Jordanova R., Svergun DI., Tucker PA. Only protein-protein interactions imex curation nowak-2006-6 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Nowak E., Panjikar S., Morth JP., Jordanova R., Svergun DI., Tucker PA. DIP original experiment: DIP-66135X Structure (London, England : 1993) 2006 IMEx Structural and functional aspects of the sensor histidine kinase PrrB from Mycobacterium tuberculosis. Nowak E., Panjikar S., Morth JP., Jordanova R., Svergun DI., Tucker PA. Only protein-protein interactions imex curation nowak-2006-7 in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Nowak E., Panjikar S., Morth JP., Jordanova R., Svergun DI., Tucker PA. DIP original experiment: DIP-66136X Structure (London, England : 1993) 2006 IMEx Structural and functional aspects of the sensor histidine kinase PrrB from Mycobacterium tuberculosis. Nowak E., Panjikar S., Morth JP., Jordanova R., Svergun DI., Tucker PA. Only protein-protein interactions imex curation nowak-2006-8 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Nowak E., Panjikar S., Morth JP., Jordanova R., Svergun DI., Tucker PA. DIP original experiment: DIP-66134X Structure (London, England : 1993) 2006 IMEx Structural and functional aspects of the sensor histidine kinase PrrB from Mycobacterium tuberculosis. Nowak E., Panjikar S., Morth JP., Jordanova R., Svergun DI., Tucker PA. Only protein-protein interactions imex curation prrb_myctu Sensor-type histidine kinase PrrB prrB MTCY31.30c Rv0902c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MNILSRIFARTPSLRTRVVVATAIGAAIPVLIVGTVVWVGITNDRKERLDRRLDEAAGFAIPFVPRGLDEIPRSPNDQDALITVRRGNVIKSNSDITLPKLQDDYADTYVRGVRYRVRTVEIPGPEPTSVAVGATYDATVAETNNLHRRVLLICTFAIGAAAVFAWLLAAFAVRPFKQLAEQTRSIDAGDEAPRVEVHGASEAIEIAEAMRGMLQRIWNEQNRTKEALASARDFAAVSSHELRTPLTAMRTNLEVLSTLDLPDDQRKEVLNDVIRTQSRIEATLSALERLAQGELSTSDDHVPVDITDLLDRAAHDAARIYPDLDVSLVPSPTCIIVGLPAGLRLAVDNAIANAVKHGGATLVQLSAVSSRAGVEIAIDDNGSGVPEGERQVVFERFSRGSTASHSGSGLGLALVAQQAQLHGGTASLENSPLGGARLVLRLPGPS CD84A335CCFFE6D7 prra_myctu Transcriptional regulatory protein PrrA prrA MTCY31.31c Rv0903c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MDTGVTSPRVLVVDDDSDVLASLERGLRLSGFEVATAVDGAEALRSATENRPDAIVLDINMPVLDGVSVVTALRAMDNDVPVCVLSARSSVDDRVAGLEAGADDYLVKPFVLAELVARVKALLRRRGSTATSSSETITVGPLEVDIPGRRARVNGVDVDLTKREFDLLAVLAEHKTAVLSRAQLLELVWGYDFAADTNVVDVFIGYLRRKLEAGGGPRLLHTVRGVGFVLRMQ This sequence has been withdrawn from Uniprot. B8B38C20BF917082 prrb-1 3141305 N/A 3141313 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false prrb-2 3141306 N/A 3141313 unspecified role unspecified role unspecified role unspecified role region 174-446 region 174-446 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false prrb-3 3141307 N/A 3141313 unspecified role unspecified role unspecified role unspecified role region 223-446 region 223-446 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false prrb-4 3141308 N/A 3141313 unspecified role unspecified role unspecified role unspecified role region 174-446 region 174-446 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false prrb-5 3141309 N/A 3141313 unspecified role unspecified role unspecified role unspecified role region 223-446 region 223-446 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false prrb-6 3141310 N/A 3141313 unspecified role unspecified role unspecified role unspecified role region 297-446 region 297-446 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false prra-prrb-1 3141311 N/A 3141314 enzyme target enzyme target substrate substrate unspecified role unspecified role ecolx Escherichia coli N/A 3141313 enzyme enzyme unspecified role unspecified role region 174-446 region 174-446 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false prrb-7 3141312 N/A 3141313 unspecified role unspecified role unspecified role unspecified role region 297-446 region 297-446 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false