DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ bewley-2006-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Bewley MC., Graziano V., Jiang J., Matz E., Studier FW., Pegg AE., Coleman CS., Flanagan JM. DIP original experiment: DIP-262553X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structures of wild-type and mutant human spermidine/spermine N1-acetyltransferase, a potential therapeutic drug target. Bewley MC., Graziano V., Jiang J., Matz E., Studier FW., Pegg AE., Coleman CS., Flanagan JM. Only protein-protein interactions imex curation bewley-2006-2 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Bewley MC., Graziano V., Jiang J., Matz E., Studier FW., Pegg AE., Coleman CS., Flanagan JM. DIP original experiment: DIP-262554X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structures of wild-type and mutant human spermidine/spermine N1-acetyltransferase, a potential therapeutic drug target. Bewley MC., Graziano V., Jiang J., Matz E., Studier FW., Pegg AE., Coleman CS., Flanagan JM. Only protein-protein interactions imex curation sat1_human Diamine acetyltransferase 1 SAT1 Spermidine/spermine N(1)-acetyltransferase 1 Putrescine acetyltransferase Polyamine N-acetyltransferase 1 SAT protein protein human Homo sapiens Human MAKFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE sat1-1 3140998 N/A 3141000 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false sat1-2 3140999 N/A 3141000 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false