DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ hamma-2005-1 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Hamma T., Reichow SL., Varani G., Ferré-D'Amaré AR. DIP original experiment: DIP-254815X Nature structural & molecular biology 2005 IMEx The Cbf5-Nop10 complex is a molecular bracket that organizes box H/ACA RNPs. Hamma T., Reichow SL., Varani G., Ferré-D'Amaré AR. Only protein-protein interactions imex curation hamma-2005-2 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Hamma T., Reichow SL., Varani G., Ferré-D'Amaré AR. DIP original experiment: DIP-254818X Nature structural & molecular biology 2005 IMEx The Cbf5-Nop10 complex is a molecular bracket that organizes box H/ACA RNPs. Hamma T., Reichow SL., Varani G., Ferré-D'Amaré AR. Only protein-protein interactions imex curation hamma-2005-3 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Hamma T., Reichow SL., Varani G., Ferré-D'Amaré AR. DIP original experiment: DIP-254816X Nature structural & molecular biology 2005 IMEx The Cbf5-Nop10 complex is a molecular bracket that organizes box H/ACA RNPs. Hamma T., Reichow SL., Varani G., Ferré-D'Amaré AR. Only protein-protein interactions imex curation hamma-2005-4 ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Hamma T., Reichow SL., Varani G., Ferré-D'Amaré AR. DIP original experiment: DIP-254819X Nature structural & molecular biology 2005 IMEx The Cbf5-Nop10 complex is a molecular bracket that organizes box H/ACA RNPs. Hamma T., Reichow SL., Varani G., Ferré-D'Amaré AR. Only protein-protein interactions imex curation hamma-2005-5 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Hamma T., Reichow SL., Varani G., Ferré-D'Amaré AR. DIP original experiment: DIP-254817X Nature structural & molecular biology 2005 IMEx The Cbf5-Nop10 complex is a molecular bracket that organizes box H/ACA RNPs. Hamma T., Reichow SL., Varani G., Ferré-D'Amaré AR. Only protein-protein interactions imex curation hamma-2005-6 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Hamma T., Reichow SL., Varani G., Ferré-D'Amaré AR. DIP original experiment: DIP-254820X Nature structural & molecular biology 2005 IMEx The Cbf5-Nop10 complex is a molecular bracket that organizes box H/ACA RNPs. Hamma T., Reichow SL., Varani G., Ferré-D'Amaré AR. Only protein-protein interactions imex curation nop10_metja Ribosome biogenesis protein Nop10 nop10 MJ0116.1 protein protein metja Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) Methanococcus jannaschii MVEMRMKKCPKCGLYTLKEICPKCGEKTVIPKPPKFSLEDRWGKYRRMLKRALKNKNKAE trub_metja Probable tRNA pseudouridine synthase B truB tRNA pseudouridine(55) synthase tRNA pseudouridylate synthase tRNA-uridine isomerase MJ0148 protein protein metja Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) Methanococcus jannaschii MILLEKTQEKKINDKEELIVKEEVETNWDYGCNPYERKIEDLIKYGVVVVDKPRGPTSHEVSTWVKKILNLDKAGHGGTLDPKVTGVLPVALERATKTIPMWHIPPKEYVCLMHLHRDASEEDILRVFKEFTGRIYQRPPLKAAVKRRLRIRKIHELELLDKDGKDVLFRVKCQSGTYIRKLCEDIGEALGTSAHMQELRRTKSGCFEEKDAVYLQDLLDAYVFWKEDGDEEELRRVIKPMEYGLRHLKKVVVKDSAVDAICHGADVYVRGIAKLSKGIGKGETVLVETLKGEAVAVGKALMNTKEILNADKGVAVDVERVYMDRGTYPRMWKRKK nop10_yeast H/ACA ribonucleoprotein complex subunit NOP10 YHR072W-A Nucleolar protein family A member 3 snoRNP protein NOP10 NOP10 Nucleolar protein 10 protein protein yeast Saccharomyces cerevisiae Baker's yeast MHLMYTLGPDGKRIYTLKKVTESGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 4718D35AF7911FBA nop10-trub-1 3139386 N/A 3139392 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3139393 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false nop10-trub-2 3139387 N/A 3139392 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3139393 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false trub-ynop10-1 3139388 N/A 3139394 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3139393 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false nop10-trub-3 3139389 N/A 3139392 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3139393 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false nop10-trub-4 3139390 N/A 3139392 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3139393 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false trub-nop10-1 3139391 N/A 3139392 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3139393 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false