DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ lorentzen-2005-1 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Lorentzen E., Walter P., Fribourg S., Evguenieva-Hackenberg E., Klug G., Conti E. DIP original experiment: DIP-254754X Nature structural & molecular biology 2005 IMEx The archaeal exosome core is a hexameric ring structure with three catalytic subunits. Lorentzen E., Walter P., Fribourg S., Evguenieva-Hackenberg E., Klug G., Conti E. Only protein-protein interactions imex curation lorentzen-2005-2 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Lorentzen E., Walter P., Fribourg S., Evguenieva-Hackenberg E., Klug G., Conti E. DIP original experiment: DIP-254762X Nature structural & molecular biology 2005 IMEx The archaeal exosome core is a hexameric ring structure with three catalytic subunits. Lorentzen E., Walter P., Fribourg S., Evguenieva-Hackenberg E., Klug G., Conti E. Only protein-protein interactions imex curation lorentzen-2005-3 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Lorentzen E., Walter P., Fribourg S., Evguenieva-Hackenberg E., Klug G., Conti E. DIP original experiment: DIP-254757X Nature structural & molecular biology 2005 IMEx The archaeal exosome core is a hexameric ring structure with three catalytic subunits. Lorentzen E., Walter P., Fribourg S., Evguenieva-Hackenberg E., Klug G., Conti E. Only protein-protein interactions imex curation lorentzen-2005-4 ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Lorentzen E., Walter P., Fribourg S., Evguenieva-Hackenberg E., Klug G., Conti E. DIP original experiment: DIP-254760X Nature structural & molecular biology 2005 IMEx The archaeal exosome core is a hexameric ring structure with three catalytic subunits. Lorentzen E., Walter P., Fribourg S., Evguenieva-Hackenberg E., Klug G., Conti E. Only protein-protein interactions imex curation lorentzen-2005-5 in vitro In vitro dls dynamic light scattering dls predetermined predetermined participant predetermined Lorentzen E., Walter P., Fribourg S., Evguenieva-Hackenberg E., Klug G., Conti E. DIP original experiment: DIP-254755X Nature structural & molecular biology 2005 IMEx The archaeal exosome core is a hexameric ring structure with three catalytic subunits. Lorentzen E., Walter P., Fribourg S., Evguenieva-Hackenberg E., Klug G., Conti E. Only protein-protein interactions imex curation lorentzen-2005-6 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Lorentzen E., Walter P., Fribourg S., Evguenieva-Hackenberg E., Klug G., Conti E. DIP original experiment: DIP-254758X Nature structural & molecular biology 2005 IMEx The archaeal exosome core is a hexameric ring structure with three catalytic subunits. Lorentzen E., Walter P., Fribourg S., Evguenieva-Hackenberg E., Klug G., Conti E. Only protein-protein interactions imex curation lorentzen-2005-7 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Lorentzen E., Walter P., Fribourg S., Evguenieva-Hackenberg E., Klug G., Conti E. DIP original experiment: DIP-254756X Nature structural & molecular biology 2005 IMEx The archaeal exosome core is a hexameric ring structure with three catalytic subunits. Lorentzen E., Walter P., Fribourg S., Evguenieva-Hackenberg E., Klug G., Conti E. Only protein-protein interactions imex curation lorentzen-2005-8 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Lorentzen E., Walter P., Fribourg S., Evguenieva-Hackenberg E., Klug G., Conti E. DIP original experiment: DIP-254759X Nature structural & molecular biology 2005 IMEx The archaeal exosome core is a hexameric ring structure with three catalytic subunits. Lorentzen E., Walter P., Fribourg S., Evguenieva-Hackenberg E., Klug G., Conti E. Only protein-protein interactions imex curation lorentzen-2005-9 ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Lorentzen E., Walter P., Fribourg S., Evguenieva-Hackenberg E., Klug G., Conti E. DIP original experiment: DIP-254761X Nature structural & molecular biology 2005 IMEx The archaeal exosome core is a hexameric ring structure with three catalytic subunits. Lorentzen E., Walter P., Fribourg S., Evguenieva-Hackenberg E., Klug G., Conti E. Only protein-protein interactions imex curation rrp41_sacs2 Exosome complex component Rrp41 rrp41 SSO0735 protein protein sulso Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) MREMLQVERPKLILDDGKRTDGRKPDELRSIKIELGVLKNADGSAIFEMGNTKAIAAVYGPKEMHPRHLSLPDRAVLRVRYHMTPFSTDERKNPAPSRREIELSKVIREALESAVLVELFPRTAIDVFTEILQADAGSRLVSLMAASLALADAGIPMRDLIAGVAVGKADGVIILDLNETEDMWGEADMPIAMMPSLNQVTLFQLNGSMTPDEFRQAFDLAVKGINIIYNLEREALKSKYVEFKEEGV mint rrp42_sacs2 Exosome complex component Rrp42 rrp42 C20_023 SSO0732 protein protein sulso Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) MSSTPSNQNIIPIIKKESIVSLFEKGIRQDGRKLTDYRPLSITLDYAKKADGSALVKLGTTMVLAGTKLEIDKPYEDTPNQGNLIVNVELLPLAYETFEPGPPDENAIELARVVDRSLRDSKALDLTKLVIEPGKSVWTVWLDVYVLDYGGNVLDACTLASVAALYNTKVYKVEQHSNGISVNKNEVVGKLPLNYPVVTISVAKVDKYLVVDPDLDEESIMDAKISFSYTPDLKIVGIQKSGKGSMSLQDIDQAENTARSTAVKLLEELKKHLGI mtr3_yeast Exosome complex component MTR3 MTR3 YGR158C G6676 mRNA transport regulator 3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNVQDRRRLLGPAAAKPMAFSNTTTHVPEKKSTDLTPKGNESEQELSLHTGFIENCNGSALVEARSLGHQTSLITAVYGPRSIRGSFTSQGTISIQLKNGLLEKYNTNELKEVSSFLMGIFNSVVNLSRYPKSGIDIFVYLTYDKDLTNNPQDDDSQSKMMSSQISSLIPHCITSITLALADAGIELVDMAGAGEANGTVVSFIKNGEEIVGFWKDDGDDEDLLECLDRCKEQYNRYRDLMISCLMNQET 2FA07ABB4A1115E0 rrp42_yeast Exosome complex component RRP42 RRP42 Ribosomal RNA-processing protein 42 YDL111C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSLSVAEKSYLYDSLASTPSIRPDGRLPHQFRPIEIFTDFLPSSNGSSRIIASDGSECIVSIKSKVVDHHVENELLQVDVDIAGQRDDALVVETITSLLNKVLKSGSGVDSSKLQLTKKYSFKIFVDVLVISSHSHPVSLISFAIYSALNSTYLPKLISAFDDLEVEELPTFHDYDMVKLDINPPLVFILAVVGNNMLLDPAANESEVANNGLIISWSNGKITSPIRSVALNDSNVKSFKPHLLKQGLAMVEKYAPDVVRSLENL 806C60979642C67E rrp45_yeast Exosome complex component RRP45 RRP45 YDR280W D9954.1 Ribosomal RNA-processing protein 45 protein protein yeast Saccharomyces cerevisiae Baker's yeast MAKDIEISASESKFILEALRQNYRLDGRSFDQFRDVEITFGKEFGDVSVKMGNTKVHCRISCQIAQPYEDRPFEGLFVISTEISPMAGSQFENGNITGEDEVLCSRIIEKSVRRSGALDVEGLCIVAGSKCWAVRADVHFLDCDGGFIDASCIAVMAGLMHFKKPDITVHGEQIIVHPVNEREPVPLGILHIPICVTFSFFNPQDTEENIKGETNSEISIIDATLKEELLRDGVLTVTLNKNREVVQVSKAGGLPMDALTLMKCCHEAYSIIEKITDQILQLLKEDSEKRNKYAAMLTSENAREI 65C9DB5A63678F2D rrp41_yeast Exosome complex component SKI6 SKI6 YGR195W G7587 ECM20 Ribosomal RNA-processing protein 41 Superkiller protein 6 Extracellular mutant protein 20 RRP41 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSRLEIYSPEGLRLDGRRWNELRRFESSINTHPHAADGSSYMEQGNNKIITLVKGPKEPRLKSQMDTSKALLNVSVNITKFSKFERSKSSHKNERRVLEIQTSLVRMFEKNVMLNIYPRTVIDIEIHVLEQDGGIMGSLINGITLALIDAGISMFDYISGISVGLYDTTPLLDTNSLEENAMSTVTLGVVGKSEKLSLLLVEDKIPLDRLENVLAIGIAGAHRVRDLMDEELRKHAQKRVSNASAR C80EFFB528A43044 rrp41-rrp42-2 3138051 N/A 3138060 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3138061 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false scrrp42-scmtr3-1 3138052 N/A 3138062 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3138063 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false scrrp41-scrrp45-1 3138053 N/A 3138064 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3138065 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false scrrp41-scrrp45-2 3138054 N/A 3138064 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3138065 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false rrp41-rrp42-3 3138055 N/A 3138060 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3138061 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false scmtr3-scrrp42-1 3138056 N/A 3138062 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3138063 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false rrp41-rrp42-4 3138057 N/A 3138060 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3138061 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false scrrp41-scrrp45-3 3138058 N/A 3138064 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3138065 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false scmtr3-scrrp42-2 3138059 N/A 3138062 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3138063 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false