DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ ma-2005-6 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. DIP original experiment: DIP-132779X Structure (London, England : 1993) 2005 IMEx The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. Only protein-protein interactions imex curation ma-2005-7 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. DIP original experiment: DIP-132777X Structure (London, England : 1993) 2005 IMEx The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. Only protein-protein interactions imex curation ma-2005-8 in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. DIP original experiment: DIP-132788X Structure (London, England : 1993) 2005 IMEx The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. Only protein-protein interactions imex curation ma-2005-9 in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. DIP original experiment: DIP-132782X Structure (London, England : 1993) 2005 IMEx The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. Only protein-protein interactions imex curation ma-2005-10 in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. DIP original experiment: DIP-132784X Structure (London, England : 1993) 2005 IMEx The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. Only protein-protein interactions imex curation ma-2005-11 in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. DIP original experiment: DIP-132786X Structure (London, England : 1993) 2005 IMEx The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. Only protein-protein interactions imex curation ma-2005-12 ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. DIP original experiment: DIP-132780X Structure (London, England : 1993) 2005 IMEx The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. Only protein-protein interactions imex curation ma-2005-13 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. DIP original experiment: DIP-132778X Structure (London, England : 1993) 2005 IMEx The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. Only protein-protein interactions imex curation ma-2005-14 in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. DIP original experiment: DIP-132783X Structure (London, England : 1993) 2005 IMEx The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. Only protein-protein interactions imex curation ma-2005-15 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. DIP original experiment: DIP-132781X Structure (London, England : 1993) 2005 IMEx The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. Only protein-protein interactions imex curation ma-2005-16 in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. DIP original experiment: DIP-132787X Structure (London, England : 1993) 2005 IMEx The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. Only protein-protein interactions imex curation ma-2005-17 in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. DIP original experiment: DIP-132785X Structure (London, England : 1993) 2005 IMEx The Gemin6-Gemin7 heterodimer from the survival of motor neurons complex has an Sm protein-like structure. Ma Y., Dostie J., Dreyfuss G., Van Duyne GD. Only protein-protein interactions imex curation gemi7_human Gem-associated protein 7 SIP3 GEMIN7 protein protein human Homo sapiens Human MQTPVNIPVPVLRLPRGPDGFSRGFAPDGRRAPLRPEVPEIQECPIAQESLESQEQRARAALRERYLRSLLAMVGHQVSFTLHEGVRVAAHFGATDLDVANFYVSQLQTPIGVQAEALLRCSDIISYTFKP gemi6_human Gem-associated protein 6 SIP2 GEMIN6 protein protein human Homo sapiens Human MSEWMKKGPLEWQDYIYKEVRVTASEKNEYKGWVLTTDPVSANIVLVNFLEDGSMSVTGIMGHAVQTVETMNEGDHRVREKLMHLFTSGDCKAYSPEDLEERKNSLKKWLEKNHIPITEQGDAPRTLCVAGVLTIDPPYGPENCSSSNEIILSRVQDLIEGHLTASQ ruxg_human Small nuclear ribonucleoprotein G SNRPG PBSCG Sm protein G protein protein human Homo sapiens Human MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV smd1_human Small nuclear ribonucleoprotein Sm D1 SNRPD1 snRNP core protein D1 Sm-D autoantigen protein protein human Homo sapiens Human MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR smd3_human Small nuclear ribonucleoprotein Sm D3 SNRPD3 snRNP core protein D3 protein protein human Homo sapiens Human MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR ruxe_human Small nuclear ribonucleoprotein E SNRPE Sm protein E protein protein human Homo sapiens Human MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN smd2_human Small nuclear ribonucleoprotein Sm D2 SNRPD2 snRNP core protein D2 SNRPD1 protein protein human Homo sapiens Human MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK ruxf_human Small nuclear ribonucleoprotein F SNRPF PBSCF Sm protein F protein protein human Homo sapiens Human MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRE p14678-2 Small nuclear ribonucleoprotein-associated proteins B and B' SNRPB COD SNRPB1 Sm protein B/B' protein protein human Homo sapiens Human MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGLL gemin6-gemin7-8 3137935 N/A 3137947 unspecified role unspecified role unspecified role unspecified role Gemin6 binding domain Region 31-131 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3137948 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false gemin6-gemin7-9 3137936 N/A 3137947 unspecified role unspecified role prey prey Gemin6 binding domain Region 31-131 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3137948 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false gemin6-snrpg-1 3137937 N/A 3137949 unspecified role unspecified role prey prey in vitro In vitro N/A 3137948 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false gemin6-snrpd1-1 3137938 N/A 3137950 unspecified role unspecified role prey prey in vitro In vitro N/A 3137948 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false gemin6-snrpd3-1 3137939 N/A 3137951 unspecified role unspecified role prey prey in vitro In vitro N/A 3137948 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false gemin6-snrpe-1 3137940 N/A 3137952 unspecified role unspecified role prey prey in vitro In vitro N/A 3137948 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false gemin6-gemin7-10 3137941 N/A 3137947 unspecified role unspecified role unspecified role unspecified role Gemin6 binding domain Region 31-131 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3137948 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false gemin6-gemin7-11 3137942 N/A 3137947 unspecified role unspecified role unspecified role unspecified role Gemin6 binding domain Region 31-131 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3137948 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false gemin6-snrpd2-1 3137943 N/A 3137953 unspecified role unspecified role prey prey in vitro In vitro N/A 3137948 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false gemin6-snrpd1-2 3137944 N/A 3137950 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3137948 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false gemin6-snrpf-1 3137945 N/A 3137954 unspecified role unspecified role prey prey in vitro In vitro N/A 3137948 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false gemin6-snrpb-1 3137946 N/A 3137955 unspecified role unspecified role prey prey in vitro In vitro N/A 3137948 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false