DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ derewenda-2004-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Derewenda U., Oleksy A., Stevenson AS., Korczynska J., Dauter Z., Somlyo AP., Otlewski J., Somlyo AV., Derewenda ZS. DIP original experiment: DIP-132896X Structure (London, England : 1993) 2004 IMEx The crystal structure of RhoA in complex with the DH/PH fragment of PDZRhoGEF, an activator of the Ca(2+) sensitization pathway in smooth muscle. Derewenda U., Oleksy A., Stevenson AS., Korczynska J., Dauter Z., Somlyo AP., Otlewski J., Somlyo AV., Derewenda ZS. Only protein-protein interactions imex curation derewenda-2004-2 in vitro In vitro gdp_gtp exchange gdp/gtp exchange assay gtp/gdp exchange guanine nucleotide exchange assay gtp/gdp exchange guanine nucleotide exchange assay gdp_gtp exchange predetermined predetermined participant predetermined Derewenda U., Oleksy A., Stevenson AS., Korczynska J., Dauter Z., Somlyo AP., Otlewski J., Somlyo AV., Derewenda ZS. DIP original experiment: DIP-132894X Structure (London, England : 1993) 2004 IMEx The crystal structure of RhoA in complex with the DH/PH fragment of PDZRhoGEF, an activator of the Ca(2+) sensitization pathway in smooth muscle. Derewenda U., Oleksy A., Stevenson AS., Korczynska J., Dauter Z., Somlyo AP., Otlewski J., Somlyo AV., Derewenda ZS. Only protein-protein interactions imex curation derewenda-2004-3 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Derewenda U., Oleksy A., Stevenson AS., Korczynska J., Dauter Z., Somlyo AP., Otlewski J., Somlyo AV., Derewenda ZS. DIP original experiment: DIP-132897X Structure (London, England : 1993) 2004 IMEx The crystal structure of RhoA in complex with the DH/PH fragment of PDZRhoGEF, an activator of the Ca(2+) sensitization pathway in smooth muscle. Derewenda U., Oleksy A., Stevenson AS., Korczynska J., Dauter Z., Somlyo AP., Otlewski J., Somlyo AV., Derewenda ZS. Only protein-protein interactions imex curation derewenda-2004-4 in vitro In vitro gdp_gtp exchange gdp/gtp exchange assay gtp/gdp exchange guanine nucleotide exchange assay gtp/gdp exchange guanine nucleotide exchange assay gdp_gtp exchange predetermined predetermined participant predetermined Derewenda U., Oleksy A., Stevenson AS., Korczynska J., Dauter Z., Somlyo AP., Otlewski J., Somlyo AV., Derewenda ZS. DIP original experiment: DIP-132895X Structure (London, England : 1993) 2004 IMEx The crystal structure of RhoA in complex with the DH/PH fragment of PDZRhoGEF, an activator of the Ca(2+) sensitization pathway in smooth muscle. Derewenda U., Oleksy A., Stevenson AS., Korczynska J., Dauter Z., Somlyo AP., Otlewski J., Somlyo AV., Derewenda ZS. Only protein-protein interactions imex curation arhgb_human Rho guanine nucleotide exchange factor 11 ARHGEF11 KIAA0380 PDZ-RhoGEF protein protein human Homo sapiens Human MSVRLPQSIDRLSSLSSLGDSAPERKSPSHHRQPSDASETTGLVQRCVIIQKDQHGFGFTVSGDRIVLVQSVRPGGAAMKAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLLGSSPSSMGISGLQQDPSPAGAPRITSVIPSPPPPPPLPPPQRITGPKPLQDPEVQKHATQILRNMLRQEEKELQDILPLYGDTSQRPSEGRLSLDSQEGDSGLDSGTERFPSLSESLMNRNSVLSDPGLDSPRTSPVIMARVAQHHRRQGSDAAVPSTGDQGVDQSPKPLIIGPEEDYDPGYFNNESDIIFQDLEKLKSRPAHLGVFLRYIFSQADPSPLLFYLCAEVYQQASPKDSRSLGKDIWNIFLEKNAPLRVKIPEMLQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRTLGLGSLYGENDLLDLDGDPLRERQVAEKQLAALGDILSKYEEDRSAPMDFALNTYMSHAGIRLREARPSNTAEKAQSAPDKDKWLPFFPKTKKSSNSKKEKDALEDKKRNPILKYIGKPKSSSQSTFHIPLSPVEVKPGNVRNIIQHFENNQQYDAPEPGTQRLSTGSFPEDLLESDSSRSEIRLGRSESLKGREEMKRSRKAENVPRSRSDVDMDAAAEATRLHQSASSSTSSLSTRSLENPTPPFTPKMGRRSIESPSLGFCTDTLLPHLLEDDLGQLSDLEPEPDAQNWQHTVGKDVVAGLTQREIDRQEVINELFVTEASHLRTLRVLDLIFYQRMKKENLMPREELARLFPNLPELIEIHNSWCEAMKKLREEGPIIKEISDLMLARFDGPAREELQQVAAQFCSYQSIALELIKTKQRKESRFQLFMQEAESHPQCRRLQLRDLIISEMQRLTKYPLLLESIIKHTEGGTSEHEKLCRARDQCREILKYVNEAVKQTENRHRLEGYQKRLDATALERASNPLAAEFKSLDLTTRKMIHEGPLTWRISKDKTLDLHVLLLEDLLVLLQKQDEKLLLKCHSKTAVGSSDSKQTFSPVLKLNAVLIRSVATDKRAFFIICTSKLGPPQIYELVALTSSDKNTWMELLEEAVRNATRHPGAAPMPVHPPPPGPREPAQQGPTPSRVELDDSDVFHGEPEPEELPGGTGSQQRVQGKHQVLLEDPEQEGSAEEEELGVLPCPSTSLDGENRGIRTRNPIHLAFPGPLFMEGLADSALEDVENLRHLILWSLLPGHTMETQAAQEPEDDLTPTPSVISVTSHPWDPGSPGQAPPGGEGDNTQLAGLEGERPEQEDMGLCSLEHLPPRTRNSGIWESPELDRNLAEDASSTEAAGGYKVVRKAEVAGSKVVPALPESGQSEPGPPEVEGGTKATGNCFYVSMPSGPPDSSTDHSEAPMSPPQPDSLPAGQTEPQPQLQGGNDDPRRPSRSPPSLALRDVGMIFHTIEQLTLKLNRLKDMELAHRELLKSLGGESSGGTTPVGSFHTEAARWTDGSLSPPAKEPLASDSRNSHELGPCPEDGSDAPLEDSTADAAASPGP rhoa_human Transforming protein RhoA Rho cDNA clone 12 ARHA RHO12 RHOA ARH12 protein protein human Homo sapiens Human MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL p60953-2 Cell division control protein 42 homolog CDC42 G25K GTP-binding protein Placental protein protein human Homo sapiens Human MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL arhgef11-rhoa-1 3137349 N/A 3137353 unspecified role unspecified role unspecified role unspecified role Region 712-1081 Region 712-1081 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3137354 unspecified role unspecified role unspecified role unspecified role Region 1-181 Region 1-181 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false arhgef11-rhoa-6 3137350 N/A 3137354 unspecified role unspecified role unspecified role unspecified role Region 1-181 Region 1-181 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3137353 unspecified role unspecified role unspecified role unspecified role Region 712-1081 Region 712-1081 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false arhgef11-rhoa-7 3137351 N/A 3137354 unspecified role unspecified role unspecified role unspecified role Region 1-181 Region 1-181 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3137353 unspecified role unspecified role unspecified role unspecified role Region 712-1081 Region 712-1081 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false arhgef11-cdc42-1 3137352 N/A 3137355 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3137353 unspecified role unspecified role unspecified role unspecified role Region 712-1081 Region 712-1081 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false