IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ bouchon-2001-1 human-monocyte Human mononuclear cells monocyte Monocyte, mononuclear cell anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Bouchon A., Hernández-Munain C., Cella M., Colonna M. Pervanadate (phosphatase inhibitor) stimulation under reducing conditions. mcolonna@pathology.wustl.edu The Journal of experimental medicine 2001 Only protein-protein interactions imex curation imex curation bouchon-2001-2 human-mddc Human Monocyte-derived dendritic cell monocyte-derived_dendritic_cell Monocyte-derived dendritic cell (MDDC) anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Bouchon A., Hernández-Munain C., Cella M., Colonna M. Pervanadate (phosphatase inhibitor) stimulation under reducing conditions. mcolonna@pathology.wustl.edu The Journal of experimental medicine 2001 Only protein-protein interactions imex curation imex curation tyobp_human TYRO protein tyrosine kinase-binding protein TYROBP DAP12 KARAP DNAX-activation protein 12 Killer-activating receptor-associated protein protein protein human Homo sapiens Human MGGLEPCSRLLLLPLLLAVSGLRPVQAQAQSDCSCSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYK trem1_human Triggering receptor expressed on myeloid cells 1 TREM1 Triggering receptor expressed on monocytes 1 protein protein human Homo sapiens Human MRKTRLWGLLWMLFVSELRAATKLTEEKYELKEGQTLDVKCDYTLEKFASSQKAWQIIRDGEMPKTLACTERPSKNSHPVQVGRIILEDYHDHGLLRVRMVNLQVEDSGLYQCVIYQPPKEPHMLFDRIRLVVTKGFSGTPGSNENSTQNVYKIPPTTTKALCPLYTSPRTVTQAPPKSTADVSTPDSEINLTNVTDIIRVPVFNIVILLAGGFLSKSLVFSVLFAVTLRSFVP trem2_human Triggering receptor expressed on myeloid cells 2 TREM2 Triggering receptor expressed on monocytes 2 protein protein human Homo sapiens Human MEPLRLLILLFVTELSGAHNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSILLLLACIFLIKILAASALWAAAWHGQKPGTHPPSELDCGHDPGYQLQTLPGLRDT 235rw3r-2 2968953 N/A 2968955 unspecified role unspecified role prey prey N/A 2968956 unspecified role unspecified role bait bait physical association physical association false false false 2C trem1-tyrobp-1 2968954 N/A 2968955 unspecified role unspecified role prey prey N/A 2968957 unspecified role unspecified role bait bait physical association physical association false false false 2C