DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ schulman-2000-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Schulman BA., Carrano AC., Jeffrey PD., Bowen Z., Kinnucan ER., Finnin MS., Elledge SJ., Harper JW., Pagano M., Pavletich NP. DIP original experiment: DIP-265095X Nature 2000 IMEx Insights into SCF ubiquitin ligases from the structure of the Skp1-Skp2 complex. Schulman BA., Carrano AC., Jeffrey PD., Bowen Z., Kinnucan ER., Finnin MS., Elledge SJ., Harper JW., Pagano M., Pavletich NP. Only protein-protein interactions imex curation schulman-2000-2 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Schulman BA., Carrano AC., Jeffrey PD., Bowen Z., Kinnucan ER., Finnin MS., Elledge SJ., Harper JW., Pagano M., Pavletich NP. DIP original experiment: DIP-265097X Nature 2000 IMEx Insights into SCF ubiquitin ligases from the structure of the Skp1-Skp2 complex. Schulman BA., Carrano AC., Jeffrey PD., Bowen Z., Kinnucan ER., Finnin MS., Elledge SJ., Harper JW., Pagano M., Pavletich NP. Only protein-protein interactions imex curation schulman-2000-3 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Schulman BA., Carrano AC., Jeffrey PD., Bowen Z., Kinnucan ER., Finnin MS., Elledge SJ., Harper JW., Pagano M., Pavletich NP. DIP original experiment: DIP-265098X Nature 2000 IMEx Insights into SCF ubiquitin ligases from the structure of the Skp1-Skp2 complex. Schulman BA., Carrano AC., Jeffrey PD., Bowen Z., Kinnucan ER., Finnin MS., Elledge SJ., Harper JW., Pagano M., Pavletich NP. Only protein-protein interactions imex curation schulman-2000-4 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Schulman BA., Carrano AC., Jeffrey PD., Bowen Z., Kinnucan ER., Finnin MS., Elledge SJ., Harper JW., Pagano M., Pavletich NP. DIP original experiment: DIP-265096X Nature 2000 IMEx Insights into SCF ubiquitin ligases from the structure of the Skp1-Skp2 complex. Schulman BA., Carrano AC., Jeffrey PD., Bowen Z., Kinnucan ER., Finnin MS., Elledge SJ., Harper JW., Pagano M., Pavletich NP. Only protein-protein interactions imex curation schulman-2000-5 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Schulman BA., Carrano AC., Jeffrey PD., Bowen Z., Kinnucan ER., Finnin MS., Elledge SJ., Harper JW., Pagano M., Pavletich NP. DIP original experiment: DIP-265099X Nature 2000 IMEx Insights into SCF ubiquitin ligases from the structure of the Skp1-Skp2 complex. Schulman BA., Carrano AC., Jeffrey PD., Bowen Z., Kinnucan ER., Finnin MS., Elledge SJ., Harper JW., Pagano M., Pavletich NP. Only protein-protein interactions imex curation q13309-1 S-phase kinase-associated protein 2 Cyclin-A/CDK2-associated protein p45 F-box protein Skp2 F-box/LRR-repeat protein 1 p45skp2 SKP2-alpha SKP2 FBXL1 protein protein human Homo sapiens Human MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLGHPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQKPSCL p63208-1 S-phase kinase-associated protein 1 SKP1 EMC19 OCP2 SKP1A TCEB1L Cyclin-A/CDK2-associated protein p19 Organ of Corti protein 2 Organ of Corti protein II RNA polymerase II elongation factor-like protein SIII p19skp1 Transcription elongation factor B polypeptide 1-like protein protein human Homo sapiens Human MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK skp1-skp2-4 3135363 N/A 3135368 unspecified role unspecified role unspecified role unspecified role 89-424 binding region 89-424 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3135369 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false skp1-skp2-5 3135364 N/A 3135369 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3135368 unspecified role unspecified role unspecified role unspecified role 89-424 binding region 89-424 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false skp1-skp2-6 3135365 N/A 3135369 unspecified role unspecified role unspecified role unspecified role 1-147 binding region 1-147 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3135368 unspecified role unspecified role unspecified role unspecified role 89- 141 binding region 89- 141 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false skp1-skp2-7 3135366 N/A 3135369 unspecified role unspecified role unspecified role unspecified role 1-147 binding region 1-147 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3135368 unspecified role unspecified role unspecified role unspecified role 89-141 binding region 89-141 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false skp2-skp1-5 3135367 N/A 3135369 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3135368 unspecified role unspecified role bait bait 89-424 binding region 89-424 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false Deletion of region 148-163 decreased the interaction rate/strength.