DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ savvides-2000-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Savvides SN., Boone T., Andrew Karplus P. DIP original experiment: DIP-262980X Nature structural biology 2000 IMEx Flt3 ligand structure and unexpected commonalities of helical bundles and cystine knots. Savvides SN., Boone T., Andrew Karplus P. Only protein-protein interactions imex curation flt3l_human Fms-related tyrosine kinase 3 ligand SL cytokine FLT3LG protein protein human Homo sapiens Human MTVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPPLLLLLLLPVGLLLLAAAWCLHWQRTRRRTPRPGEQVPPVPSPQDLLLVEH flt3lg-1 3135297 N/A 3135298 unspecified role unspecified role unspecified role unspecified role 27-160 binding region 27-160 binding region binding region binding-associated region binding region predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false