MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint liu-2016-2 human-mel_juso Homo sapiens mel_juso anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu X., BoseDasgupta S., Jayachandran R., Studer V., Rühl S., Stiess M., Pieters J. jean.pieters@unibas.ch FEBS letters 2016 Only protein-protein interactions imex curation imex curation liu-2016-1 in vitro In vitro enzymatic study enzymatic study autoradiography autoradiography Liu X., BoseDasgupta S., Jayachandran R., Studer V., Rühl S., Stiess M., Pieters J. jean.pieters@unibas.ch FEBS letters 2016 Only protein-protein interactions imex curation imex curation cor1a_mouse Coronin-1A Coro1a Coro1 Coronin-like protein A Coronin-like protein p57 Tryptophan aspartate-containing coat protein protein protein mouse Mus musculus Mouse MSRQVVRSSKFRHVFGQPAKADQCYEDVRVSQTTWDSGFCAVNPKFMALICEASGGGAFLVLPLGKTGRVDKNVPLVCGHTAPVLDIAWCPHNDNVIASGSEDCTVMVWEIPDGGLVLPLREPVITLEGHTKRVGIVAWHPTAQNVLLSAGCDNVILVWDVGTGAAVLTLGPDVHPDTIYSVDWSRDGALICTSCRDKRVRVIEPRKGTVVAEKDRPHEGTRPVHAVFVSEGKILTTGFSRMSERQVALWDTKHLEEPLSLQELDTSSGVLLPFFDPDTNIVYLCGKGDSSIRYFEITSEAPFLHYLSMFSSKESQRGMGYMPKRGLEVNKCEIARFYKLHERKCEPIAMTVPRKSDLFQEDLYPPTAGPDPALTAEEWLGGRDAGPLLISLKDGYVPPKSRELRVNRGLDSARRRATPEPSGTPSSDTVSRLEEDVRNLNAIVQKLQERLDRLEETVQAK gnas2_human Guanine nucleotide-binding protein G(s) subunit alpha isoforms short Adenylate cyclase-stimulating G alpha protein GNAS GNAS1 GSP protein protein human Homo sapiens Human MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSDGEKATKVQDIKNNLKEAIETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL cd5r1_human Cyclin-dependent kinase 5 activator 1 Cyclin-dependent kinase 5 regulatory subunit 1 TPKII regulatory subunit CDK5R1 CDK5R NCK5A protein protein human Homo sapiens Human MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR coro1a-1 1915987 N/A 1915989 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell O89053:p.Thr418Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false O89053:p.Thr424Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false O89053:p.[Thr418Ala;Thr424Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false N/A 1915990 unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f2c gnas-coro1a-1 1915987 N/A 1915989 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell undefined mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false undefined mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false O89053:p.[Thr418Glu;Thr424Glu] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false N/A 1915990 unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f3a cdk5r1-coro1a-1 1915988 N/A 1915991 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified N/A 1915989 enzyme target enzyme target substrate substrate neutral component neutral component purified purified phosphorylation phosphorylation reaction phosphorylation false false false f1b