UniProt UniProt http://www.uniprot.org mir-2014-4 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mir RA., Bele A., Mirza S., Srivastava S., Olou AA., Ammons SA., Kim JH., Gurumurthy CB., Qiu F., Band H., Band V. vband@unmc.edu Molecular and cellular biology 2014 Only protein-protein interactions imex curation imex curation mir-2014-1 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Mir RA., Bele A., Mirza S., Srivastava S., Olou AA., Ammons SA., Kim JH., Gurumurthy CB., Qiu F., Band H., Band V. vband@unmc.edu Molecular and cellular biology 2014 Only protein-protein interactions imex curation imex curation mir-2014-6 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Mir RA., Bele A., Mirza S., Srivastava S., Olou AA., Ammons SA., Kim JH., Gurumurthy CB., Qiu F., Band H., Band V. vband@unmc.edu Molecular and cellular biology 2014 Only protein-protein interactions imex curation imex curation mir-2014-2 human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mir RA., Bele A., Mirza S., Srivastava S., Olou AA., Ammons SA., Kim JH., Gurumurthy CB., Qiu F., Band H., Band V. vband@unmc.edu Molecular and cellular biology 2014 Only protein-protein interactions imex curation imex curation mir-2014-7 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Mir RA., Bele A., Mirza S., Srivastava S., Olou AA., Ammons SA., Kim JH., Gurumurthy CB., Qiu F., Band H., Band V. vband@unmc.edu Molecular and cellular biology 2014 Only protein-protein interactions imex curation imex curation mir-2014-3 mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mir RA., Bele A., Mirza S., Srivastava S., Olou AA., Ammons SA., Kim JH., Gurumurthy CB., Qiu F., Band H., Band V. vband@unmc.edu Molecular and cellular biology 2014 Only protein-protein interactions imex curation imex curation mir-2014-5 in vitro In vitro tap tandem affinity purification TAP TAP tap ms participant Identification by mass spectrometry ms participant Mir RA., Bele A., Mirza S., Srivastava S., Olou AA., Ammons SA., Kim JH., Gurumurthy CB., Qiu F., Band H., Band V. 76NTERT cell lysates were incubated with glutathione-Sepharose bead-bound GST-ECD-FLAG and protein complexes eluted by cleaving the ECD-FLAG portion with PreScission protease. Eluted ECD-FLAG in complex with bound proteins was further affinity purified using FLAG beads and then eluted using excess FLAG peptide. vband@unmc.edu Molecular and cellular biology 2014 Only protein-protein interactions imex curation imex curation mir-2014-8 in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Mir RA., Bele A., Mirza S., Srivastava S., Olou AA., Ammons SA., Kim JH., Gurumurthy CB., Qiu F., Band H., Band V. vband@unmc.edu Molecular and cellular biology 2014 Only protein-protein interactions imex curation imex curation rpap3_human RNA polymerase II-associated protein 3 RPAP3 protein protein human Homo sapiens Human MTSANKAIELQLQVKQNAEELQDFMRDLENWEKDIKQKDMELRRQNGVPEENLPPIRNGNFRKKKKGKAKESSKKTREENTKNRIKSYDYEAWAKLDVDRILDELDKDDSTHESLSQESESEEDGIHVDSQKALVLKEKGNKYFKQGKYDEAIDCYTKGMDADPYNPVLPTNRASAYFRLKKFAVAESDCNLAVALNRSYTKAYSRRGAARFALQKLEEAKKDYERVLELEPNNFEATNELRKISQALASKENSYPKEADIVIKSTEGERKQIEAQQNKQQAISEKDRGNGFFKEGKYERAIECYTRGIAADGANALLPANRAMAYLKIQKYEEAEKDCTQAILLDGSYSKAFARRGTARTFLGKLNEAKQDFETVLLLEPGNKQAVTELSKIKKELIEKGHWDDVFLDSTQRQNVVKPIDNPPHPGSTKPLKKVIIEETGNLIQTIDVPDSTTAAAPENNPINLANVIAATGTTSKKNSSQDDLFPTSDTPRAKVLKIEEVSDTSSLQPQASLKQDVCQSYSEKMPIEIEQKPAQFATTVLPPIPANSFQLESDFRQLKSSPDMLYQYLKQIEPSLYPKLFQKNLDPDVFNQIVKILHDFYIEKEKPLLIFEILQRLSELKRFDMAVMFMSETEKKIARALFNHIDKSGLKDSSVEELKKRYGG ruvb2_human RuvB-like 2 RUVBL2 TIP48 TIP49B CGI-46 48 kDa TATA box-binding protein-interacting protein TIP49b Repressing pontin 52 51 kDa erythrocyte cytosolic protein INO80J TIP60-associated protein 54-beta INO80 complex subunit J protein protein human Homo sapiens Human MATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS ruvb1_human RuvB-like 1 RUVBL1 NMP238 TIP49 TIP49A 49 kDa TATA box-binding protein-interacting protein TIP49a Pontin 52 Nuclear matrix protein 238 54 kDa erythrocyte cytosolic protein INO80H TIP60-associated protein 54-alpha INO80 complex subunit H protein protein human Homo sapiens Human MKIEEVKSTTKTQRIASHSHVKGLGLDESGLAKQAASGLVGQENAREACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDVHKKKEIIQDVTLHDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGEINKVVNKYIDQGIAELVPGVLFVDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKINGKDSIEKEHVEEISELFYDAKSSAKILADQQDKYMK pihd1_human PIH1 domain-containing protein 1 PIH1D1 NOP17 Nucleolar protein 17 homolog protein protein human Homo sapiens Human MANPKLLGMGLSEAEAIGADSARFEELLLQASKELQQAQTTRPESTQIQPQPGFCIKTNSSEGKVFINICHSPSIPPPADVTEEELLQMLEEDQAGFRIPMSLGEPHAELDAKGQGCTAYDVAVNSDFYRRMQNSDFLRELVITIAREGLEDKYNLQLNPEWRMMKNRPFMGSISQQNIRSEQRPRIQELGDLYTPAPGRAESGPEKPHLNLWLEAPDLLLAEVDLPKLDGALGLSLEIGENRLVMGGPQQLYHLDAYIPLQINSHESKAAFHRKRKQLMVAMPLLPVPS ecd_human Protein ecdysoneless homolog Human suppressor of GCR two ECD protein protein human Homo sapiens Human MEETMKLATMEDTVEYCLFLIPDESRDSDKHKEILQKYIERIITRFAPMLVPYIWQNQPFNLKYKPGKGGVPAHMFGVTKFGDNIEDEWFIVYVIKQITKEFPELVARIEDNDGEFLLIEAADFLPKWLDPENSTNRVFFCHGELCIIPAPRKSGAESWLPTTPPTIPQALNIITAHSEKILASESIRAAVNRRIRGYPEKIQASLHRAHCFLPAGIVAVLKQRPRLVAAAVQAFYLRDPIDLRACRVFKTFLPETRIMTSVTFTKCLYAQLVQQRFVPDRRSGYRLPPPSDPQYRAHELGMKLAHGFEILCSKCSPHFSDCKKSLVTASPLWASFLESLKKNDYFKGLIEGSAQYRERLEMAENYFQLSVDWPESSLAMSPGEEILTLLQTIPFDIEDLKKEAANLPPEDDDQWLDLSPDQLDQLLQEAVGKKESESVSKEEKEQNYDLTEVSESMKAFISKVSTHKGAELPREPSEAPITFDADSFLNYFDKILGPRPNESDSDDLDDEDFECLDSDDDLDFETHEPGEEASLKGTLDNLKSYMAQMDQELAHTCISKSFTTRNQVEPVSQTTDNNSDEEDSGTGESVMAPVDVDLNLVSNILESYSSQAGLAGPASNLLQSMGVQLPDNTDHRPTSKPTKN prp8_human Pre-mRNA-processing-splicing factor 8 Splicing factor Prp8 PRP8 homolog 220 kDa U5 snRNP-specific protein p220 PRPC8 PRPF8 protein protein human Homo sapiens Human MAGVFPYRGPGNPVPGPLAPLPDYMSEEKLQEKARKWQQLQAKRYAEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRKFRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLYHITGAISFVNEIPWVIEPVYISQWGSMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNILDVEPLEAIQLELDPEEDAPVLDWFYDHQPLRDSRKYVNGSTYQRWQFTLPMMSTLYRLANQLLTDLVDDNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDINKIIIRQPIRTEYKIAFPYLYNNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPISHRHSVKSQEPLPDDDEEFELPEFVEPFLKDTPLYTDNTANGIALLWAPRPFNLRSGRTRRALDIPLVKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATKFFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLTKLVVDSHVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAAGWRVWLFFMRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSEAWRCWKANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPYITAEEAVAVYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGINNLQDVWETSEGECNVMLESRFEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFIVQYYGLVMDLLVLGLHRASEMAGPPQMPNDFLSFQDIATEAAHPIRLFCRYIDRIHIFFRFTADEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSVTTVQWENSFVSVYSKDNPNLLFNMCGFECRILPKCRTSYEEFTHKDGVWNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAVVNTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHEEDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAIAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRTDFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKWKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQELDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWNVSRPSLLADSKDVMDSTTTQKYWIDIQLRWGDYDSHDIERYARAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGSKPLIQQAMAKIMKANPALYVLRERIRKGLQLYSSEPTEPYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLTATQTRTVNKHGDEIITSTTSNYETQTFSSKTEWRVRAISAANLHLRTNHIYVSSDDIKETGYTYILPKNVLKKFICISDLRAQIAGYLYGVSPPDNPQVKEIRCIVMVPQWGTHQTVHLPGQLPQHEYLKEMEPLGWIHTQPNESPQLSPQDVTTHAKIMADNPSWDGEKTIIITCSFTPGSCTLTAYKLTPSGYEWGRQNTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPAQSSWNYNFMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFALLQEGEVYSADREDLYA rb_human Retinoblastoma-associated protein pRb pp110 p105-Rb RB1 p110-RB1 protein protein human Homo sapiens Human MPPKTPRKTAATAAAAAAEPPAPPPPPPPEEDPEQDSGPEDLPLVRLEFEETEEPDFTALCQKLKIPDHVRERAWLTWEKVSSVDGVLGGYIQKKKELWGICIFIAAVDLDEMSFTFTELQKNIEISVHKFFNLLKEIDTSTKVDNAMSRLLKKYDVLFALFSKLERTCELIYLTQPSSSISTEINSALVLKVSWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLSPPMLLKEPYKTAVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFMNSLGLVTSNGLPEVENLSKRYEEIYLKNKDLDARLFLDHDKTLQTDSIDSFETQRTPRKSNLDEEVNVIPPHTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHLESACPLNLPLQNNHTAADMYLSPVRSPKKKGSTTRVNSTANAETQATSAFQTQKPLKSTSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEK ecd_mouse Protein ecdysoneless homolog Ecd protein protein mouse Mus musculus Mouse MEGSGKLAMVEDAVEYHLFLIPDKARGTEEHREILQKYIERIMTQFAPILVPYIWQNQPFNLKYKPAKGGVPAHMYGMTKFGDNIEDEWFIVYVIKQITKEFPELVARVEDNDGEFLLIEAADFLPKWLDPDNSANRVFFHHGELCIIPVPRKSERIPWLPMTPPTIQQALSIISAHPEAVLASESIQAAVDRRVSGYPERVEASLHRAHCFLPAGIVAVLKQQPRLLSAAVQAFYLRDPIDLRACRVFKTFLPETRIMASVTFTKCLYAQLVQQKFVPDRRSGYGLPPPSHPQYRAYELGMKLAHGFEILCSKCSPHFSDSRKSLVTASPLWASFLESLKRNDYFKGLMDGSAQYQERLEMAKNYFQLSIHRPESSLAMSPGEEILTVLQTQPFDVAELKTEEADLPPEDDDQWLDLSPDQLDQLLQDAAGRKESQPGPQKEELQNYDVAQVSDSMKAFISKVSSHKGAELPRDPSEAPITFDADSFLNYFDKILGAKPQESDSEDDPGEEDVEGVDSDDDVGFEAQESESLKGALGSLKSYMARMDQELAHTSMGRSFTTRERLNKDPPSHTANDNSDEEDSGAGDCAVEAVDVDLNLISNILESYSSQAGLAGPASNLLHSMGVRLPDNADHNPQVSQ mint pihd1_mouse PIH1 domain-containing protein 1 Pih1d1 Nop17 Nucleolar protein 17 homolog protein protein mouse Mus musculus Mouse MADSTFLAPELSDTESMGEETVRFQELLLKASKELQQAQTARPDSTQIQPKPGFCVKTNSSEGKVFINICHSPSIPPPADVTEDELLQMLEEDQAGFRIPMSLGEPHAELDAKGQGCTAYDVAVNSNFYLRMQNSDFLRELVVTIAREGLEDKYGLQLNPEWRMLKYRSFLGSISQQNIRSQQRPRIQELGTLDASGSLGTCHGPERPHLNLWLEAPDLLLAEVDLPKLDGAQGLALEIGENRLVIGGPQQLYHLDATVPLRINSEASRAAFHRRRKQLMVSMPLLTASS csk2b_human Casein kinase II subunit beta Phosvitin Protein G5a CSNK2B CK2N G5A protein protein human Homo sapiens Human MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR csk21_human Casein kinase II subunit alpha CSNK2A1 CK2A1 protein protein human Homo sapiens Human MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMPGGSTPVSSANMMSGISSVPTPSPLGPLAGSPVIAAANPLGMPVPAAAGAQQ pih1d1-ecd-2 1925403 N/A 1925411 unspecified role unspecified role prey prey N/A 1925412 unspecified role unspecified role prey prey N/A 1925413 unspecified role unspecified role prey prey N/A 1925414 unspecified role unspecified role bait bait N/A 1925415 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection Transfected ECD mutants constructs 3S/A (ser503ala, ser505ala, ser518ala), 6S/A (ser503ala, ser505ala, ser518ala, ser572ala,ser579ala,ser564ala), and del499-527 were precipitated to the same extent as the wildtype association association false false false 4D pih1d1-ecd-3 1925403 N/A 1925411 unspecified role unspecified role prey prey N/A 1925412 unspecified role unspecified role prey prey N/A 1925413 unspecified role unspecified role prey prey N/A 1925414 unspecified role unspecified role bait bait N/A 1925415 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Transfected ECD mutants constructs 3S/A (ser503ala, ser505ala, ser518ala), 6S/A (ser503ala, ser505ala, ser518ala, ser572ala,ser579ala,ser564ala), and del499-527 were precipitated to the same extent as the wildtype association association false false false 4E ecd-prpf8-2 1925403 N/A 1925416 unspecified role unspecified role prey prey N/A 1925415 unspecified role unspecified role bait bait physical association physical association false false false supplemental S3E pih1d1-ecd-6 1925403 N/A 1925413 unspecified role unspecified role prey prey N/A 1925414 unspecified role unspecified role bait bait N/A 1925415 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Transfected ECD mutants constructs 3S/A (ser503ala, ser505ala, ser518ala), 6S/A (ser503ala, ser505ala, ser518ala, ser572ala,ser579ala,ser564ala), and del499-527 were precipitated to the same extent as the wildtype association association false false false supplemental S3A pih1d1-ecd-7 1925403 N/A 1925415 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection N/A 1925414 unspecified role unspecified role bait bait physical association physical association false false false supplemental S3B Phosphatase treatment did not change the interaction ecd-pih1d1-3 1925403 N/A 1925415 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection N/A 1925414 unspecified role unspecified role prey prey physical association physical association false false false supplemental S3C Phosphatase treatment did not change the interaction pih1d1-ecd-1 1925404 N/A 1925414 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 1925415 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false O95905:p.[Ser503Ala;Ser505Ala;Ser518Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false O95905:p.[Ser503Ala;Ser505Ala;Ser518Ala;Ser572Ala;Ser579Ala;Ser584Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false O95905:p.[Ser503Asp;Ser505Asp;Ser518Asp;Ser572Asp;Ser579Asp;Ser584Asp] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false 4A, supplemental S3D ecd-ruvbl1-2 1925404 N/A 1925413 unspecified role unspecified role prey prey cell lysate cell lysate region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 1925415 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false 6A Only the full-length ECD interacts with RUVBL1. ecd-ruvbl1-3 1925404 N/A 1925413 unspecified role unspecified role prey prey cell lysate cell lysate region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 1925415 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false 6B Only the full-length ECD interacts with RUVBL1. pih1d1-ecd-5 1925404 N/A 1925414 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 1925415 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association false false false 6E pih1d1-ecd-4 1925405 N/A 1925413 unspecified role unspecified role bait bait N/A 1925415 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Transfected ECD mutants construct 6S/A (ser503ala, ser505ala, ser518ala, ser572ala,ser579ala,ser564ala) precipitated to the same extent as the wildtype physical association physical association false false false supplemental S4B rb1-ecd-1 1925405 N/A 1925417 unspecified role unspecified role bait bait N/A 1925415 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Transfected ECD mutants construct 6S/A (ser503ala, ser505ala, ser518ala, ser572ala,ser579ala,ser564ala) precipitated to the same extent as the wildtype physical association physical association false false false supplemental S4F ruvbl1-ecd-1 1925405 N/A 1925413 unspecified role unspecified role bait bait N/A 1925415 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Transfected ECD mutants construct 6S/A (ser503ala, ser505ala, ser518ala, ser572ala,ser579ala,ser564ala) precipitated to the same extent as the wildtype physical association physical association false false false 5B ecd-pih1d1-1 1925406 N/A 1925414 unspecified role unspecified role prey prey N/A 1925415 unspecified role unspecified role bait bait physical association physical association false false false 4B ecd-ruvbl1-1 1925406 N/A 1925415 unspecified role unspecified role bait bait N/A 1925413 unspecified role unspecified role prey prey physical association physical association false false false 5C PIH1D1 knock down does not change the association ecd-ruvbl1-4 1925407 N/A 1925413 unspecified role unspecified role prey prey cell lysate cell lysate human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 1925415 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false supplemental S4C ecd-ruvbl1-5 1925407 N/A 1925413 unspecified role unspecified role prey prey cell lysate cell lysate human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 1925414 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) N/A 1925412 unspecified role unspecified role prey prey human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. association association false false false supplemental S4E ecd-pih1d1-2 1925408 N/A 1925418 unspecified role unspecified role bait bait N/A 1925419 unspecified role unspecified role prey prey physical association physical association false false false 4C ecd-prpf8-1 1925409 N/A 1925416 unspecified role unspecified role prey prey cell lysate cell lysate human-76ntert human 76N TERT immortalized mammary epithelial cell line Human 76ntert 76N TERT immortalized mammary epithelial cell line N/A 1925413 unspecified role unspecified role prey prey cell lysate cell lysate human-76ntert human 76N TERT immortalized mammary epithelial cell line Human 76ntert 76N TERT immortalized mammary epithelial cell line N/A 1925415 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) association association false false false 5A csnk2a1-csnk2b-7 1925410 N/A 1925420 enzyme regulator enzyme regulator neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 N/A 1925421 enzyme enzyme neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 N/A 1925415 enzyme target enzyme target substrate substrate neutral component neutral component purified purified c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false false false 3B