HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html al_jubair-2015-1 in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Al-Jubair T., Mukherjee O., Oosterhuis S., Singh B., Su YC., Fleury C., Blom AM., Törnroth-Horsefield S., Riesbeck K., Al-Jubair T., Mukherjee O., Oosterhuis S., Singh B., Su YC., Fleury C., Blom AM., Törnroth-Horsefield S., Riesbeck K. kristian.riesbeck@ med.lu.se Journal of immunology (Baltimore, Md. : 1950) 2015 imex curation Only protein-protein interactions imex curation al_jubair-2015-2 in vitro In vitro facs fluorescence-activated cell sorting FACS Flow cytometry facs antibody detection identification by antibody antibody detection Al-Jubair T., Mukherjee O., Oosterhuis S., Singh B., Su YC., Fleury C., Blom AM., Törnroth-Horsefield S., Riesbeck K., Al-Jubair T., Mukherjee O., Oosterhuis S., Singh B., Su YC., Fleury C., Blom AM., Törnroth-Horsefield S., Riesbeck K. kristian.riesbeck@ med.lu.se Journal of immunology (Baltimore, Md. : 1950) 2015 imex curation Only protein-protein interactions imex curation al_jubair-2015-3 in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Al-Jubair T., Mukherjee O., Oosterhuis S., Singh B., Su YC., Fleury C., Blom AM., Törnroth-Horsefield S., Riesbeck K., Al-Jubair T., Mukherjee O., Oosterhuis S., Singh B., Su YC., Fleury C., Blom AM., Törnroth-Horsefield S., Riesbeck K. kristian.riesbeck@ med.lu.se Journal of immunology (Baltimore, Md. : 1950) 2015 imex curation Only protein-protein interactions imex curation heparin Heparin small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) vtnc_human Vitronectin VTN Serum-spreading factor V75 S-protein protein protein human Homo sapiens Human MAPLRPLLILALLAWVALADQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL a0a024a2c9_haeif lph tbp2 ERS515280_00355 protein protein haeif Haemophilus influenzae MNINLKKFSLTILAALTLTACGSGSGASASNAPTAQPSTPATQPSEQAVLEMPKRSPTNTGLVFSIKTESEEDSVGQINTINNEQELSNRTLTSIDVDGKQIPIAFTENWNEAKYIEQPLNGVPHICCNKYTAMRFGAIASNEAGQNDILFYNGIPTEKLPDSGEVTYEGESIMTSKESVIPDDYMKGSSKFIVNFGDKKLSGSLIIDTTKSTSSSQKVKIDIEKAKITGNTFSGTAQSDSFKSQGIAEGKFYGDGAKELGGMVKAKDNSWAGAYGAKAQ cfah_human Complement factor H CFH HF HF1 HF2 H factor 1 protein protein human Homo sapiens Human MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVKTCSKSSIDIENGFISESQYTYALKEKAKYQCKLGYVTADGETSGSITCGKDGWSAQPTCIKSCDIPVFMNARTKNDFTWFKLNDTLDYECHDGYESNTGSTTGSIVCGYNGWSDLPICYERECELPKIDVHLVPDRKKDQYKVGEVLKFSCKPGFTIVGPNSVQCYHFGLSPDLPICKEQVQSCGPPPELLNGNVKEKTKEEYGHSEVVEYYCNPRFLMKGPNKIQCVDGEWTTLPVCIVEESTCGDIPELEHGWAQLSSPPYYYGDSVEFNCSESFTMIGHRSITCIHGVWTQLPQCVAIDKLKKCKSSNLIILEEHLKNKKEFDHNSNIRYRCRGKEGWIHTVCINGRWDPEVNCSMAQIQLCPPPPQIPNSHNMTTTLNYRDGEKVSVLCQENYLIQEGEEITCKDGRWQSIPLCVEKIPCSQPPQIEHGTINSSRSSQESYAHGTKLSYTCEGGFRISEENETTCYMGKWSSPPQCEGLPCKSPPEISHGVVAHMSDSYQYGEEVTYKCFEGFGIDGPAIAKCLGEKWSHPPSCIKTDCLSLPSFENAIPMGEKKDVYKAGEQVTYTCATYYKMDGASNVTCINSRWTGRPTCRDTSCVNPPTVQNAYIVSRQMSKYPSGERVRYQCRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR hpe_haei3 Surface-adhesin protein E pe CGSHi3655_04936 protein protein Haemophilus influenzae (strain NTHi 3655) Haemophilus influenzae (strain NTHi 3655) MKKIILTLSLGLLTACSAQIQKAEQNDMKLAPPTDVRSGYIRLVKNVNYYIDSESIWVDNQEPQIVHFDAVVNLDKGLYVYPEPKRYARSVRQYKILNCANYHLTQVRTDFYDEFWGQGLRAAPKKQKKHTLSLTPDTTLYNAAQIICANYGKAFSVDKK ph-vn-1 2843334 N/A 2843337 inhibitor inhibitor unspecified role unspecified role N/A 2843338 unspecified role unspecified role prey prey human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 2843339 unspecified role unspecified role bait bait purified purified region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false 3B ph-fh-2 2843334 N/A 2843340 unspecified role unspecified role bait bait N/A 2843339 unspecified role unspecified role prey prey purified purified region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false 1A pe-vn-1 2843334 N/A 2843338 unspecified role unspecified role prey prey human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 2843341 unspecified role unspecified role bait bait purified purified ecoli Escherichia coli (strain K12) physical association physical association false false false 2A ph-vn-2 2843334 N/A 2843338 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 2843339 unspecified role unspecified role bait bait purified purified region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false 2A, 2C, 3C and Supp. Figs 1 and 2 Interaction was not disrupted by addition of Factor H lph-vtn-2 2843334 N/A 2843338 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) N/A 2843339 unspecified role unspecified role prey prey purified purified region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association false false false 1A lph-cfh-1 2843334 N/A 2843340 unspecified role unspecified role prey prey N/A 2843339 unspecified role unspecified role bait bait purified purified region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false 2D and S2 Interaction was not disrupted by addition of Vitronectin lph-vtn-1 2843334 N/A 2843338 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 2843339 unspecified role unspecified role bait bait purified purified region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false Supp. Figs 1 Interaction was not disrupted by addition of Factor H lph-vtn-3 2843335 N/A 2843338 unspecified role unspecified role unspecified role unspecified role region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 2843339 unspecified role unspecified role unspecified role unspecified role purified purified ecoli Escherichia coli (strain K12) physical association physical association false false false 1D & 3E lph-vtn-4 2843335 N/A 2843339 unspecified role unspecified role unspecified role unspecified role purified purified haeif Haemophilus influenzae N/A 2843338 unspecified role unspecified role unspecified role unspecified role region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1C and 3D ph-vn-3 2843336 N/A 2843338 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 2843339 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 2843336 2B