IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ liu-2017-1 in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Liu S, Liu S., Mozaffari-Jovin S., Wollenhaupt J., Santos KF., Theuser M., Dunin-Horkawicz S., Fabrizio P., Bujnicki JM., Lührmann R., Wahl MC. mwahl@zedat.fu-berlin.de,Reinhard.Luehrmann@mpi-bpc.mpg.de reinhard.luehrmann@mpi-bpc.mpg.de eLife 2014 imex curation Only protein-protein interactions liu-2014-6 in vitro In vitro enzymatic study enzymatic study weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Liu S, Liu S., Mozaffari-Jovin S., Wollenhaupt J., Santos KF., Theuser M., Dunin-Horkawicz S., Fabrizio P., Bujnicki JM., Lührmann R., Wahl MC. mwahl@zedat.fu-berlin.de,Reinhard.Luehrmann@mpi-bpc.mpg.de reinhard.luehrmann@mpi-bpc.mpg.de eLife 2014 imex curation Only protein-protein interactions liu-2014-5 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Liu S, Liu S., Mozaffari-Jovin S., Wollenhaupt J., Santos KF., Theuser M., Dunin-Horkawicz S., Fabrizio P., Bujnicki JM., Lührmann R., Wahl MC. mwahl@zedat.fu-berlin.de,Reinhard.Luehrmann@mpi-bpc.mpg.de reinhard.luehrmann@mpi-bpc.mpg.de eLife 2014 imex curation Only protein-protein interactions liu-2014-7 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Liu S, Liu S., Mozaffari-Jovin S., Wollenhaupt J., Santos KF., Theuser M., Dunin-Horkawicz S., Fabrizio P., Bujnicki JM., Lührmann R., Wahl MC. mwahl@zedat.fu-berlin.de,Reinhard.Luehrmann@mpi-bpc.mpg.de reinhard.luehrmann@mpi-bpc.mpg.de eLife 2014 imex curation Only protein-protein interactions liu-2014-8 yeast Saccharomyces cerevisiae Baker's yeast cosedimentation cosedimentation northern blot northern blot northen Liu S, Liu S., Mozaffari-Jovin S., Wollenhaupt J., Santos KF., Theuser M., Dunin-Horkawicz S., Fabrizio P., Bujnicki JM., Lührmann R., Wahl MC. mwahl@zedat.fu-berlin.de,Reinhard.Luehrmann@mpi-bpc.mpg.de reinhard.luehrmann@mpi-bpc.mpg.de eLife 2014 imex curation Only protein-protein interactions u6-1_human_snrna small nuclear RNA U6-1 snrna small nuclear rna snRNA snrna human Homo sapiens Human GUGCUCGCUUCGGCAGCACAUAUACUAAAAUUGGAACGAUACAGAGAAGAUUAGCAUGGCCCCUGCGCAAGGAUGACACGCAAAUUCGUGAAGCGUUCCAUAUUUU snrna u4-1 Small nuclear RNA U4-1 snrna small nuclear rna snRNA snrna human Homo sapiens Human AGCUUUGCGCAGUGGCAGUAUCGUAGCCAAUGAGGUCUAUCCGAGGCGCGAUUAUUGCUAAUUGAAAACUUUUCCCAAUACCCCGCCGUGACGACUUGCAAUAUAGUCGGCACUGGCAAUUUUUGACAGUCUCUACGGAGACUG prpf3_human U4/U6 small nuclear ribonucleoprotein Prp3 Pre-mRNA-splicing factor 3 U4/U6 snRNP 90 kDa protein PRPF3 HPRP3 PRP3 protein protein human Homo sapiens Human MALSKRELDELKPWIEKTVKRVLGFSEPTVVTAALNCVGKGMDKKKAADHLKPFLDDSTLRFVDKLFEAVEEGRSSRHSKSSSDRSRKRELKEVFGDDSEISKESSGVKKRRIPRFEEVEEEPEVIPGPPSESPGMLTKLQIKQMMEAATRQIEERKKQLSFISPPTPQPKTPSSSQPERLPIGNTIQPSQAATFMNDAIEKARKAAELQARIQAQLALKPGLIGNANMVGLANLHAMGIAPPKVELKDQTKPTPLILDEQGRTVDATGKEIELTHRMPTLKANIRAVKREQFKQQLKEKPSEDMESNTFFDPRVSIAPSQRQRRTFKFHDKGKFEKIAQRLRTKAQLEKLQAEISQAARKTGIHTSTRLALIAPKKELKEGDIPEIEWWDSYIIPNGFDLTEENPKREDYFGITNLVEHPAQLNPPVDNDTPVTLGVYLTKKEQKKLRRQTRREAQKELQEKVRLGLMPPPEPKVRISNLMRVLGTEAVQDPTKVEAHVRAQMAKRQKAHEEANAARKLTAEQRKVKKIKKLKEDISQGVHISVYRVRNLSNPAKKFKIEANAGQLYLTGVVVLHKDVNVVVVEGGPKAQKKFKRLMLHRIKWDEQTSNTKGDDDEESDEEAVKKTNKCVLVWEGTAKDRSFGEMKFKQCPTENMAREHFKKHGAEHYWDLALSESVLESTD prp3_yeast U4/U6 small nuclear ribonucleoprotein PRP3 PRP3 RNA3 YDR473C D8035.16 Pre-mRNA-splicing factor 3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MPPRNTYEKGNPKRQNSPYYKPSFLRREETTNDEEKFQGHGLKTELHSALKSSNLNLIRRTYQTGENPYLSDPHDRGSSSRFNRRYERGLKFYQKGEISKRIAQERTLQKQQEEEELKRKLKQEEDEKDKRKLIESGDLPNLELHEDKFLLDLSKFKIYYDNNHGYEWWDTAYLDEKGELMEKYDMNGTSPAEEKLAEDIDEVDDDDDDEHPSIRYVAHPLPEKINEAKVSIKAYLTQHERKRLRRNRRKMAREAREIKIKLGLLPKPEPKVKLSNMMSVFENDQNITDPTAWEKVVKDQVDLRKRKHLEENERRHEDAIKRRKEAVNMNVEKPTVYHCKVFQFKNLQNPKIRFKLKMNSKELSLKGLCLRIRDDGPGIIIVVGNEKSCKFYENLVMKRIKWNEDFELHTNTGDIKMDMHNNSISKTWEGYLQDCKFKGWFMKVCNDQDSLLRTLGQFDSEHFYSPVQT E977FD9F708BDD91 snru6_yeast small nuclear RNA U6 Yeast snrna small nuclear rna snRNA snrna yeast Saccharomyces cerevisiae Baker's yeast GUUCGCGAAGUAACCCUUCGUGGACAUUUGGUCAAUUUGAAACAAUACAGAGAUGAUCAGCAGUUCCCCUGCAUAAGGAUGAACCGUUUUACAAAGAGAUUUAUUUCGUUUU snr14_u4_yeast SNR14 snrna small nuclear rna snRNA snrna yeast Saccharomyces cerevisiae Baker's yeast AUCCUUAUGCACGGGAAAUACGCAUAUCAGUGAGGAUUCGUCCGAGAUUGUGUUUUUGCUGGUUGAAAUUUAAUUAUAAACCAGACCGUCUCCUCAUGGUCAAUUCGGUGUUCGCUUUUGAAUACUUCAAGACUAUGUAGGGAAUUUUUGGAAUACCUUU snu13_yeast 13 kDa ribonucleoprotein-associated protein YEL026W SNU13 Small nuclear ribonucleoprotein-associated protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSAPNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASITTNDASAIKTQIYAVKDKIETLLI 4489780153E8F182 prp31_yeast Pre-mRNA-processing factor 31 PRP31 YGR091W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSEEDYFDELEYDLADEVNEEKEDIQTKKLTTVNCQTEKFNPFEILPESIELFRTLALISPDRLSLSETAQILPKIVDLKRILQQQEIDFIKLLPFFNEIIPLIKSNIKLMHNFLISLYSRRFPELSSLIPSPLQYSKVISILENENYSKNESDELFFHLENKAKLTREQILVLTMSMKTSFKNKEPLDIKTRTQILEANSILENLWKLQEDIGQYIASKISIIAPNVCFLVGPEIAAQLIAHAGGVLEFSRIPSCNIASIGKNKHLSHELHTLESGVRQEGYLFASDMIQKFPVSVHKQMLRMLCAKVSLAARVDAGQKNGDRNTVLAHKWKAELSKKARKLSEAPSISETKALPIPEDQPKKKRAGRKFRKYKEKFRLSHVRQLQNRMEFGKQEQTVLDSYGEEVGLGMSNTSLQQAVGATSGSRRSAGNQAKLTKVMKHRISEANQQADEFLISLGHNTEQPNLSPEMVQMHKKQHTNPEEETNWFSGHG E39AC6247859FB3B brr2_yeast Pre-mRNA-splicing helicase BRR2 BRR2 RSS1 SNU246 YER172C SYGP-ORF66 Protein Snu246 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTEHETKDKAKKIREIYRYDEMSNKVLKVDKRFMNTSQNPQRDAEISQPKSMSGRISAKDMGQGLCNNINKGLKENDVAVEKTGKSASLKKIQQHNTILNSSSDFRLHYYPKDPSNVETYEQILQWVTEVLGNDIPHDLIIGTADIFIRQLKENEENEDGNIEERKEKIQHELGINIDSLKFNELVKLMKNITDYETHPDNSNKQAVAILADDEKSDEEEVTEMSNNANVLGGEINDNEDDDEEYDYNDVEVNSKKKNKRALPNIENDIIKLSDSKTSNIESVPIYSIDEFFLQRKLRSELGYKDTSVIQDLSEKILNDIETLEHNPVALEQKLVDLLKFENISLAEFILKNRSTIFWGIRLAKSTENEIPNLIEKMVAKGLNDLVEQYKFRETTHSKRELDSGDDQPQSSEAKRTKFSNPAIPPVIDLEKIKFDESSKLMTVTKVSLPEGSFKRVKPQYDEIHIPAPSKPVIDYELKEITSLPDWCQEAFPSSETTSLNPIQSKVFHAAFEGDSNMLICAPTGSGKTNIALLTVLKALSHHYNPKTKKLNLSAFKIVYIAPLKALVQEQVREFQRRLAFLGIKVAELTGDSRLSRKQIDETQVLVSTPEKWDITTRNSNNLAIVELVRLLIIDEIHLLHDDRGPVLESIVARTFWASKYGQEYPRIIGLSATLPNYEDVGRFLRVPKEGLFYFDSSFRPCPLSQQFCGIKERNSLKKLKAMNDACYEKVLESINEGNQIIVFVHSRKETSRTATWLKNKFAEENITHKLTKNDAGSKQILKTEAANVLDPSLRKLIESGIGTHHAGLTRSDRSLSEDLFADGLLQVLVCTATLAWGVNLPAHTVIIKGTDVYSPEKGSWEQLSPQDVLQMLGRAGRPRYDTFGEGIIITDQSNVQYYLSVLNQQLPIESQFVSKLVDNLNAEVVAGNIKCRNDAVNWLAYTYLYVRMLASPMLYKVPDISSDGQLKKFRESLVHSALCILKEQELVLYDAENDVIEATDLGNIASSFYINHASMDVYNRELDEHTTQIDLFRIFSMSEEFKYVSVRYEEKRELKQLLEKAPIPIREDIDDPLAKVNVLLQSYFSQLKFEGFALNSDIVFIHQNAGRLLRAMFEICLKRGWGHPTRMLLNLCKSATTKMWPTNCPLRQFKTCPVEVIKRLEASTVPWGDYLQLETPAEVGRAIRSEKYGKQVYDLLKRFPKMSVTCNAQPITRSVMRFNIEIIADWIWDMNVHGSLEPFLLMLEDTDGDSILYYDVLFITPDIVGHEFTLSFTYELKQHNQNNLPPNFFLTLISENWWHSEFEIPVSFNGFKLPKKFPPPTPLLENISISTSELGNDDFSEVFEFKTFNKIQSQVFESLYNSNDSVFVGSGKGTGKTAMAELALLNHWRQNKGRAVYINPSGEKIDFLLSDWNKRFSHLAGGKIINKLGNDPSLNLKLLAKSHVLLATPVQFELLSRRWRQRKNIQSLELMIYDDAHEISQGVYGAVYETLISRMIFIATQLEKKIRFVCLSNCLANARDFGEWAGMTKSNIYNFSPSERIEPLEINIQSFKDVEHISFNFSMLQMAFEASAAAAGNRNSSSVFLPSRKDCMEVASAFMKFSKAIEWDMLNVEEEQIVPYIEKLTDGHLRAPLKHGVGILYKGMASNDERIVKRLYEYGAVSVLLISKDCSAFACKTDEVIILGTNLYDGAEHKYMPYTINELLEMVGLASGNDSMAGKVLILTSHNMKAYYKKFLIEPLPTESYLQYIIHDTLNNEIANSIIQSKQDCVDWFTYSYFYRRIHVNPSYYGVRDTSPHGISVFLSNLVETCLNDLVESSFIEIDDTEAEVTAEVNGGDDEATEIISTLSNGLIASHYGVSFFTIQSFVSSLSNTSTLKNMLYVLSTAVEFESVPLRKGDRALLVKLSKRLPLRFPEHTSSGSVSFKVFLLLQAYFSRLELPVDFQNDLKDILEKVVPLINVVVDILSANGYLNATTAMDLAQMLIQGVWDVDNPLRQIPHFNNKILEKCKEINVETVYDIMALEDEERDEILTLTDSQLAQVAAFVNNYPNVELTYSLNNSDSLISGVKQKITIQLTRDVEPENLQVTSEKYPFDKLESWWLVLGEVSKKELYAIKKVTLNKETQQYELEFDTPTSGKHNLTIWCVCDSYLDADKELSFEINVK DFAF7E3B7168D944 snr7s_u5_yeast small nuclear RNA U5 Yeast snrna small nuclear rna snRNA snrna yeast Saccharomyces cerevisiae Baker's yeast AAGCAGCUUUACAGAUCAAUGGCGGAGGGAGGUCAACAUCAAGAACUGUGGGCCUUUUAUUGCCUAUAGAACUUAUAACGAACAUGGUUCUUGCCUUUUACCAGAACCAUCCGGGUGUUGUCUCCAUAGAAACAGGUAAAGCUGUCCGUUACUGUGGGCUUGCCAUAUUUUUUGGAACU sn114_yeast Pre-mRNA-splicing factor SNU114 GIN10 YKL173W YKL637 SNU114 Growth inhibitory protein 10 114 kDa U5 small nuclear ribonucleoprotein component protein protein yeast Saccharomyces cerevisiae Baker's yeast MEGDDLFDEFGNLIGVDPFDSDEEESVLDEQEQYQTNTFEGSGNNNEIESRQLTSLGSKKELGISLEHPYGKEVEVLMETKNTQSPQTPLVEPVTERTKLQEHTIFTQLKKNIPKTRYNRDYMLSMANIPERIINVGVIGPLHSGKTSLMDLLVIDSHKRIPDMSKNVELGWKPLRYLDNLKQEIDRGLSIKLNGSTLLCTDLESKSRMINFLDAPGHVNFMDETAVALAASDLVLIVIDVVEGVTFVVEQLIKQSIKNNVAMCFVINKLDRLILDLKLPPMDAYLKLNHIIANINSFTKGNVFSPIDNNIIFASTKLGFTFTIKEFVSYYYAHSIPSSKIDDFTTRLWGSVYYHKGNFRTKPFENVEKYPTFVEFILIPLYKIFSYALSMEKDKLKNLLRSNFRVNLSQEALQYDPQPFLKHVLQLIFRQQTGLVDAITRCYQPFELFDNKTAHLSIPGKSTPEGTLWAHVLKTVDYGGAEWSLVRIYSGLLKRGDTVRILDTSQSESRQKRQLHDISKTETSNEDEDEDDETPSCEVEEIGLLGGRYVYPVHEAHKGQIVLIKGISSAYIKSATLYSVKSKEDMKQLKFFKPLDYITEAVFKIVLQPLLPRELPKLLDALNKISKYYPGVIIKVEESGEHVILGNGELYMDCLLYDLRASYAKIEIKISDPLTVFSESCSNESFASIPVSNSISRLGEENLPGLSISVAAEPMDSKMIQDLSRNTLGKGQNCLDIDGIMDNPRKLSKILRTEYGWDSLASRNVWSFYNGNVLINDTLPDEISPELLSKYKEQIIQGFYWAVKEGPLAEEPIYGVQYKLLSISVPSDVNIDVMKSQIIPLMKKACYVGLLTAIPILLEPIYEVDITVHAPLLPIVEELMKKRRGSRIYKTIKVAGTPLLEVRGQVPVIESAGFETDLRLSTNGLGMCQLYFWHKIWRKVPGDVLDKDAFIPKLKPAPINSLSRDFVMKTRRRKGISTGGFMSNDGPTLEKYISAELYAQLRENGLVP 5CE30CEFF154D013 snr7l_yeast_ncrna SNR7-L snrna small nuclear rna snRNA snrna yeast Saccharomyces cerevisiae Baker's yeast AAGCAGCUUUACAGAUCAAUGGCGGAGGGAGGUCAACAUCAAGAACUGUGGGCCUUUUAUUGCCUAUAGAACUUAUAACGAACAUGGUUCUUGCCUUUUACCAGAACCAUCCGGGUGUUGUCUCCAUAGAAACAGGUAAAGCUGUCCGUUACUGUGGGCUUGCCAUAUUUUUUGGAACUUUUCUGCCCUUUUUCUCAAUGAGUAAGGAGGGCGU u4 homo-prpf3-2 2858135 N/A 2858140 unspecified role unspecified role bait bait U4 binding binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 2858141 unspecified role unspecified role bait bait U6 binding binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 2858142 unspecified role unspecified role prey prey tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) 2858156 2858154 direct interaction direct interaction false false false 2858135 Fig1B the U4/U6 construct only contains stem II plus 13 nucleotides of U6 and the two RNAs are linked by GAAA loop u4 homo-prpf3-1 2858135 N/A 2858141 unspecified role unspecified role bait bait U6 binding binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 2858142 unspecified role unspecified role prey prey tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 2858140 unspecified role unspecified role bait bait U4 binding binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro 2858168 2858163 direct interaction direct interaction false false false Fig1B the U4/U6 construct only contains stem II plus 13 nucleotides of U6 and the two RNAs are linked by GAAA loop yprp3 u4 u6-1 2858135 N/A 2858143 unspecified role unspecified role prey prey Q03338:p.Lys355Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q03338:p.Arg304Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false Q03338:p.Arg353Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false Q03338:p.Phe354Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false Q03338:p.Lys355Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q03338:p.Arg322Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false Q03338:p.Met358Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false Q03338:p.Lys361Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false Q03338:p.Glu362Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false Q03338:p.Ser364Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false Q03338:p.Arg399Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false Q03338:p.His409Glu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false Q03338:p.Phe441His mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 2858144 unspecified role unspecified role bait bait G81C mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false A82C mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false C85A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false G86C mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false C69G mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false the mutation only decreases affinity for the PrP3 296-469 construct, and does not change that for Prp3 325-469 construct U4 binding binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 2858145 unspecified role unspecified role bait bait c12g mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false The mutation only decreases affinity for the PrP3 296-469 construct, and does not change that for Prp3 325-469 construct U6 binding binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro 2858194 2858191 direct interaction direct interaction false false false 2858135 Fig1C, 1E, 1F; Fig4 I, J the U4/U6 construct only contains stem II plus 13 nucleotides of U6 snr14_u4_yeast-prp3-5 2858135 N/A 2858143 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 2858144 unspecified role unspecified role bait bait U4 binding binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 2858145 unspecified role unspecified role bait bait binding U6 binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Fig2C The U4/U6 construct is different from the one used in EBI-13949516 and the two full lenght RNAs are fused The co-presence of Snu13 and Prp31 increase the binding snr14_u4_yeast-snu13-1 2858135 N/A 2858146 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) N/A 2858144 unspecified role unspecified role bait bait U4 binding binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 2858145 unspecified role unspecified role bait bait binding U6 binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro 2858207 2858205 direct interaction direct interaction false false false Fig2C The U4/U6 construct is different from the one used in EBI-13949516 and the two full lenght RNAs are fused snr14_u4_yeast-prp31-3 2858135 N/A 2858147 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 2858146 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) N/A 2858144 unspecified role unspecified role bait bait U4 binding binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 2858145 unspecified role unspecified role bait bait binding U6 binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Fig2C The U4/U6 construct is different from the one used in EBI-13949516 and the two full lenght RNAs are fused brr2 u4/u6-1 2858136 N/A 2858144 enzyme target enzyme target substrate substrate neutral component neutral component in vitro In vitro N/A 2858148 enzyme enzyme neutral component neutral component trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 2858145 enzyme target enzyme target substrate substrate neutral component neutral component in vitro In vitro enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction false false false Fig2A,B The presence of Prp3 (296-469) inhibits the reaction brr2-snr14_u4_yeast-1 2858136 N/A 2858143 inhibitor inhibitor neutral component neutral component region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 2858144 enzyme target enzyme target substrate substrate neutral component neutral component in vitro In vitro N/A 2858148 enzyme enzyme neutral component neutral component trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 2858145 enzyme target enzyme target substrate substrate neutral component neutral component in vitro In vitro enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction false false false Fig2A,B The presence of Prp3 (296-469) inhibits the reaction prp3 u4/u6-1 2858137 N/A 2858144 unspecified role unspecified role neutral component neutral component binding u4 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 2858143 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q03338:p.Arg304Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q03338:p.Arg322Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) 2858137 N/A 2858145 unspecified role unspecified role neutral component neutral component binding U6 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro 2858235 2858228 direct interaction direct interaction false false false Fig1D prp3-snr14_u4_yeast-1 2858138 N/A 2858144 unspecified role unspecified role neutral component neutral component binding u4 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 2858143 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) 2858138 N/A 2858145 unspecified role unspecified role neutral component neutral component binding U6 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro 2858242 2858238 direct interaction direct interaction false false false Tab1, Fig 3, Fig4 R-Value Free: 0.299, R-Value Work: 0.249 3.25A u4_5_6 prp3-1 2858139 N/A 2858144 unspecified role unspecified role neutral component neutral component yeast Saccharomyces cerevisiae Baker's yeast N/A 2858149 unspecified role unspecified role neutral component neutral component yeast Saccharomyces cerevisiae Baker's yeast N/A 2858143 unspecified role unspecified role neutral component neutral component Q03338:p.[Arg304Ala;Arg322Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q03338:p.[Arg399Ala;Phe441Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false yeast Saccharomyces cerevisiae Baker's yeast N/A 2858150 unspecified role unspecified role neutral component neutral component yeast Saccharomyces cerevisiae Baker's yeast N/A 2858151 unspecified role unspecified role neutral component neutral component yeast Saccharomyces cerevisiae Baker's yeast N/A 2858145 unspecified role unspecified role neutral component neutral component yeast Saccharomyces cerevisiae Baker's yeast colocalization colocalization false false false Fig 5 C, D, E