HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html hu-2014-7 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Hu X., Yu J., Zhou X., Li Z., Xia Y., Luo Z., Wu Y. xiaopeng_hu@hust.edu.cn Molecular medicine reports 2014 imex curation Only protein-protein interactions imex curation hu-2014-1 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 pull down pull down western blot western blot Immuno blot Immuno blot Hu X., Yu J., Zhou X., Li Z., Xia Y., Luo Z., Wu Y. xiaopeng_hu@hust.edu.cn Molecular medicine reports 2014 imex curation Only protein-protein interactions imex curation hu-2014-2 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Hu X., Yu J., Zhou X., Li Z., Xia Y., Luo Z., Wu Y. xiaopeng_hu@hust.edu.cn Molecular medicine reports 2014 imex curation Only protein-protein interactions imex curation hu-2014-4 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Hu X., Yu J., Zhou X., Li Z., Xia Y., Luo Z., Wu Y. xiaopeng_hu@hust.edu.cn Molecular medicine reports 2014 imex curation Only protein-protein interactions imex curation hu-2014-5 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret tag fluorescence tag visualisation by fluorescence tag fluorescence Hu X., Yu J., Zhou X., Li Z., Xia Y., Luo Z., Wu Y. xiaopeng_hu@hust.edu.cn Molecular medicine reports 2014 imex curation Only protein-protein interactions imex curation hu-2014-3 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Hu X., Yu J., Zhou X., Li Z., Xia Y., Luo Z., Wu Y. xiaopeng_hu@hust.edu.cn Molecular medicine reports 2014 imex curation Only protein-protein interactions imex curation hu-2014-6 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 frap fluorescence recovery after photobleaching frap tag fluorescence tag visualisation by fluorescence tag fluorescence Hu X., Yu J., Zhou X., Li Z., Xia Y., Luo Z., Wu Y. xiaopeng_hu@hust.edu.cn Molecular medicine reports 2014 imex curation Only protein-protein interactions imex curation pak1_human Serine/threonine-protein kinase PAK 1 PAK1 p21-activated kinase 1 p65-PAK Alpha-PAK protein protein human Homo sapiens Human MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNNH gtp guanosine triphosphate - GTP 5'-GTP GTP Guanosine 5'-triphosphate guanosine 5'-triphosphoric acid guanosine triphosphate GUANOSINE-5'-TRIPHOSPHATE H4gtp guanosine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) InChI=1/C10H16N5O14P3/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-6(17)5(16)3(27-9)1-26-31(22,23)29-32(24,25)28-30(19,20)21/h2-3,5-6,9,16-17H,1H2,(H,22,23)(H,24,25)(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1/f/h14,19-20,22,24H,11H2 rac1_human Ras-related C3 botulinum toxin substrate 1 RAC1 MIG5 p21-Rac1 Ras-like protein TC25 Cell migration-inducing gene 5 protein TC25 protein protein human Homo sapiens Human MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL q98pk8_mycpu Chromosome partition protein Smc smc MYPU_7140 protein protein Mycoplasma pulmonis (strain UAB CTIP) Mycoplasma pulmonis (strain UAB CTIP) MKLIKIQAHGFKSFAEPIQLSFDGGVAGIIGPNGSGKSNINDAIKWVLGEQSSKSLRGDNMEDVIFAGSKNVKEMNKASVTLTFDNSNNASSVPHKVFTITRELERGKGSNIYYINDEIVRYKDIKDIALESGISKSSLAIISQGTVSDIAEASPEDRRGIFEEAAGVSKYKSRKKEALRKLEKTNESLEKIQTVILELEKQLKPLKNQAEKARIYLQKSKELKDVEVGLIIHNLDFYSTKLKEFEIELEGVVETKENLEQQVRKCENIIEQNSGDRLKFEKELHFLVQDLDNLNEKLRNLELISANENQRRELIISGQIKVNPEEKMKVIKEQLQIIKSRINFYTKQTEELSQIVSDKKNEVQELEKTISTKRIEQNKISNKLNETKVKINILLEHKKNKTNMFKGTKTIVEHKNIFKGYHGLVSEVLKVDQEYIPAIDAVLNNALQHIVVEDAQIAVTAVNFLKKNDGGRATFIPLKSIKPKSIKDEHFLALNMKKGFIDVASNLVKYEPKFEVLSKFLLGNILVVSDIESAKDIAAILDNKYMIVTLEGDLIRTGGVITGGVQQASTNLIGLDEQIAKLEEIVPIISKEVENTSNQITNLEHKKYELTNVVSEFSVEAAKVYEKLSNDQKSFDSLTAEYQTISAKDLGESSSSALDQQINEIQAKKVILQAQIRAKKESILSLNTDFSKVTLEKNDLEKSLRILNDSFSKKITEKNKAEFYLDTNQKRLSEFYNMTYEMAKDNFSLSIDITEAEEFVGRIKEEIKDLGNINIDSIKSYEEISERYDGLKATESEIVDAKDKIESAIKEMDKIIITKLRDTLSAINEEFNNVFQSMFGGGEARVEFVDPSDILESGIDIKAQPPGKSIKNLKLFSGGEKSLIAISLLFAILKSKPLPLCILDEVEAALDDANVVRYAEYLQKLKTKTQFLVITHRHGTMSRVDHLFGATMQTRGVTSFFSVELARAKELIKDTKIES stat3_human Signal transducer and activator of transcription 3 Acute-phase response factor STAT3 APRF protein protein human Homo sapiens Human MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQHRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNYQLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGNGGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWYNMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYSGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILSTKPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM 6C00632211C8012D pak1-rac1-18 2867569 N/A 2867576 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 2867577 cofactor cofactor coenzyme unspecified role unspecified role region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 2867578 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false 2867587 2867585 physical association physical association false false false 3A N‑terminal sequence (amino acids 9‑248) of Smc Mycoplasma pulmonis pak1-rac1-21 2867569 N/A 2867576 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 2867578 unspecified role unspecified role prey prey physical association physical association false false false 3A N‑terminal sequence (amino acids 9‑248) of Smc Mycoplasma pulmonis smc-rac1-1 2867570 N/A 2867578 unspecified role unspecified role prey prey N/A 2867579 unspecified role unspecified role bait bait n terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false sglp region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 2867580 unspecified role unspecified role prey prey association association false false false 2A smc-rac1-2 2867571 N/A 2867578 unspecified role unspecified role prey prey N/A 2867579 unspecified role unspecified role bait bait n terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false sglp region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 2867580 unspecified role unspecified role prey prey association association false false false 2B smc-stat3-3 2867572 N/A 2867580 unspecified role unspecified role neutral component neutral component N/A 2867579 unspecified role unspecified role neutral component neutral component sglp region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false 2C rac1-smc-1 2867573 N/A 2867578 acceptor acceptor unspecified role unspecified role Dsred tag rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2867579 donor donor unspecified role unspecified role n terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false sglp region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false proximity proximity close-contact colocalization neighbourhood interaction false false false 2D rac1-smc-2 2867574 N/A 2867579 unspecified role unspecified role neutral component neutral component sglp region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 2867578 unspecified role unspecified role neutral component neutral component Dsred tag rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false 2D rac1-smc-3 2867575 N/A 2867578 unspecified role unspecified role neutral component neutral component Dsred tag rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2867579 unspecified role unspecified role neutral component neutral component n terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false sglp region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 2 E