IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ wang-2012-6 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang S., Wu X., Pan T., Song W., Wang Y., Zhang F., Yuan Z. Virus - Publications including interactions involving viral proteins Viral NS5A and NS5B DNA fragments were generated from HCV genotype 1b BB7 replicon cDNA;the coding sequence of pBB7 is similar to that of the genotype 1b Con 1 strain of HCV except for one nucleotide mutation resulting in an amino acid change of S2204I within NS5A. (PMID:18559648) The Uniprot Identifier for the Con1 strain polyprotein is Q9WMX2 with a S2204I (NS5A S232I) mutation for BB7. Viperin has been assumed to be of Human origin based on the sequence length given in Fig 3D. The numbering of VAP-A has assumed to have been based on version 2 of the sequence in UniProt (242 amino acids in length), not the current V3, as V3 has 7 additional aas at the N-terminus. zhyuan@shmu.edu.cn The Journal of general virology 2012 imex curation Only protein-protein interactions wang-2012-9 human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang S., Wu X., Pan T., Song W., Wang Y., Zhang F., Yuan Z. Virus - Publications including interactions involving viral proteins Viral NS5A and NS5B DNA fragments were generated from HCV genotype 1b BB7 replicon cDNA;the coding sequence of pBB7 is similar to that of the genotype 1b Con 1 strain of HCV except for one nucleotide mutation resulting in an amino acid change of S2204I within NS5A. (PMID:18559648) The Uniprot Identifier for the Con1 strain polyprotein is Q9WMX2 with a S2204I (NS5A S232I) mutation for BB7. Viperin has been assumed to be of Human origin based on the sequence length given in Fig 3D. The numbering of VAP-A has assumed to have been based on version 2 of the sequence in UniProt (242 amino acids in length), not the current V3, as V3 has 7 additional aas at the N-terminus. zhyuan@shmu.edu.cn The Journal of general virology 2012 imex curation Only protein-protein interactions wang-2012-8 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Wang S., Wu X., Pan T., Song W., Wang Y., Zhang F., Yuan Z. Virus - Publications including interactions involving viral proteins Viral NS5A and NS5B DNA fragments were generated from HCV genotype 1b BB7 replicon cDNA;the coding sequence of pBB7 is similar to that of the genotype 1b Con 1 strain of HCV except for one nucleotide mutation resulting in an amino acid change of S2204I within NS5A. (PMID:18559648) The Uniprot Identifier for the Con1 strain polyprotein is Q9WMX2 with a S2204I (NS5A S232I) mutation for BB7. Viperin has been assumed to be of Human origin based on the sequence length given in Fig 3D. The numbering of VAP-A has assumed to have been based on version 2 of the sequence in UniProt (242 amino acids in length), not the current V3, as V3 has 7 additional aas at the N-terminus. zhyuan@shmu.edu.cn The Journal of general virology 2012 imex curation Only protein-protein interactions wang-2012-7 human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wang S., Wu X., Pan T., Song W., Wang Y., Zhang F., Yuan Z. Virus - Publications including interactions involving viral proteins Viral NS5A and NS5B DNA fragments were generated from HCV genotype 1b BB7 replicon cDNA;the coding sequence of pBB7 is similar to that of the genotype 1b Con 1 strain of HCV except for one nucleotide mutation resulting in an amino acid change of S2204I within NS5A. (PMID:18559648) The Uniprot Identifier for the Con1 strain polyprotein is Q9WMX2 with a S2204I (NS5A S232I) mutation for BB7. Viperin has been assumed to be of Human origin based on the sequence length given in Fig 3D. The numbering of VAP-A has assumed to have been based on version 2 of the sequence in UniProt (242 amino acids in length), not the current V3, as V3 has 7 additional aas at the N-terminus. zhyuan@shmu.edu.cn The Journal of general virology 2012 imex curation Only protein-protein interactions wang-2012-10 human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Wang S., Wu X., Pan T., Song W., Wang Y., Zhang F., Yuan Z. Virus - Publications including interactions involving viral proteins Viral NS5A and NS5B DNA fragments were generated from HCV genotype 1b BB7 replicon cDNA;the coding sequence of pBB7 is similar to that of the genotype 1b Con 1 strain of HCV except for one nucleotide mutation resulting in an amino acid change of S2204I within NS5A. (PMID:18559648) The Uniprot Identifier for the Con1 strain polyprotein is Q9WMX2 with a S2204I (NS5A S232I) mutation for BB7. Viperin has been assumed to be of Human origin based on the sequence length given in Fig 3D. The numbering of VAP-A has assumed to have been based on version 2 of the sequence in UniProt (242 amino acids in length), not the current V3, as V3 has 7 additional aas at the N-terminus. zhyuan@shmu.edu.cn The Journal of general virology 2012 imex curation Only protein-protein interactions vapa_human Vesicle-associated membrane protein-associated protein A VAPA VAP33 33 kDa VAMP-associated protein protein protein human Homo sapiens Human MASASGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSPLPSLLVVIAAIFIGFFLGKFIL rsad2_human Radical S-adenosyl methionine domain-containing protein 2 RSAD2 CIG5 Cytomegalovirus-induced gene 5 protein Viperin Virus inhibitory protein, endoplasmic reticulum-associated, interferon-inducible protein protein human Homo sapiens Human MWVLTPAAFAGKLLSVFRQPLSSLWRSLVPLFCWLRATFWLLATKRRKQQLVLRGPDETKEEEEDPPLPTTPTSVNYHFTRQCNYKCGFCFHTAKTSFVLPLEEAKRGLLLLKEAGMEKINFSGGEPFLQDRGEYLGKLVRFCKVELRLPSVSIVSNGSLIRERWFQNYGEYLDILAISCDSFDEEVNVLIGRGQGKKNHVENLQKLRRWCRDYRVAFKINSVINRFNVEEDMTEQIKALNPVRWKVFQCLLIEGENCGEDALREAERFVIGDEEFERFLERHKEVSCLVPESNQKMKDSYLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYIWSKADLKLDW q9wmx2-pro_0000037551 Non-structural protein 5A protein protein hcvco Hepatitis C virus genotype 1b (isolate Con1) (HCV) SGSWLRDVWDWICTVLTDFKTWLQSKLLPRLPGVPFFSCQRGYKGVWRGDGIMQTTCPCGAQITGHVKNGSMRIVGPRTCSNTWHGTFPINAYTTGPCTPSPAPNYSRALWRVAAEEYVEVTRVGDFHYVTGMTTDNVKCPCQVPAPEFFTEVDGVRLHRYAPACKPLLREEVTFLVGLNQYLVGSQLPCEPEPDVAVLTSMLTDPSHITAETAKRRLARGSPPSLASSSASQLSAPSLKATCTTRHDSPDADLIEANLLWRQEMGGNITRVESENKVVILDSFEPLQAEEDEREVSVPAEILRRSRKFPRAMPIWARPDYNPPLLESWKDPDYVPPVVHGCPLPPAKAPPIPPPRRKRTVVLSESTVSSALAELATKTFGSSESSAVDSGTATASPDQPSDDGDAGSDVESYSSMPPLEGEPGDPDLSDGSWSTVSEEASEDVVCC 1973 2419 q9wmx2-pro_0000037552 RNA-directed RNA polymerase protein protein hcvco Hepatitis C virus genotype 1b (isolate Con1) (HCV) SMSYTWTGALITPCAAEETKLPINALSNSLLRHHNLVYATTSRSASLRQKKVTFDRLQVLDDHYRDVLKEMKAKASTVKAKLLSVEEACKLTPPHSARSKFGYGAKDVRNLSSKAVNHIRSVWKDLLEDTETPIDTTIMAKNEVFCVQPEKGGRKPARLIVFPDLGVRVCEKMALYDVVSTLPQAVMGSSYGFQYSPGQRVEFLVNAWKAKKCPMGFAYDTRCFDSTVTENDIRVEESIYQCCDLAPEARQAIRSLTERLYIGGPLTNSKGQNCGYRRCRASGVLTTSCGNTLTCYLKAAAACRAAKLQDCTMLVCGDDLVVICESAGTQEDEASLRAFTEAMTRYSAPPGDPPKPEYDLELITSCSSNVSVAHDASGKRVYYLTRDPTTPLARAAWETARHTPVNSWLGNIIMYAPTLWARMILMTHFFSILLAQEQLEKALDCQIYGACYSIEPLDLPQIIQRLHGLSAFSLHSYSPGEINRVASCLRKLGVPPLRVWRHRARSVRARLLSQGGRAATCGKYLFNWAVRTKLKLTPIPAASQLDLSSWFVAGYSGGDIYHSLSRARPRWFMWCLLLLSVGVGIYLLPNR 2420 3010 45twt-1 2867748 N/A 2867753 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 2867754 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2A, 3B rsad2-vapa-4 2867748 N/A 2867753 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2867754 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 3E vapa-rsad2-1 2867748 N/A 2867753 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2867755 unspecified role unspecified role prey prey Q9WMX2-PRO_0000037551:p.Ser232Ile mutation mutation certain certain sequence position certain certain certain sequence position certain false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 5A vapa-q9wmx2_pro_0000037551-1 2867748 N/A 2867753 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2867755 unspecified role unspecified role bait bait Q9WMX2-PRO_0000037551:p.Ser232Ile mutation mutation certain certain sequence position certain certain certain sequence position certain false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 5A-RHS vapa-q9wmx2_pro_0000037551-2 2867748 N/A 2867754 inhibitor inhibitor prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2867753 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2867755 unspecified role unspecified role prey prey Q9WMX2-PRO_0000037551:p.Ser232Ile mutation mutation certain certain sequence position certain certain certain sequence position certain false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 5Ai In the presence of viperin, the level of immunoprecipitated myc–NS5A was markedly reduced. q9wmx2_pro_0000037551-vapa-1 2867748 N/A 2867754 inhibitor inhibitor prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2867753 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2867755 unspecified role unspecified role bait bait Q9WMX2-PRO_0000037551:p.Ser232Ile mutation mutation certain certain sequence position certain certain certain sequence position certain false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 5A-RHS The level of immunoprecipitated FLAG–hVAP-33 in cells transfected with HA–viperin was greatly reduced. q9wmx2_pro_0000037551-rsad2-3 2867748 N/A 2867754 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2867753 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2867756 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6A-LHS q9wmx2_pro_0000037551-vapa-3 2867748 N/A 2867753 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2867756 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 6A-LHS vapa-q9wmx2_pro_0000037551-5 2867748 N/A 2867754 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2867753 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2867756 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6A RHS Very little myc-NS5B appears to have been precipitated (lanes 3 and 4). vapa-q9wmx2_pro_0000037551-6 2867748 N/A 2867753 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2867756 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 6A -RHS Very little myc-NS5B appears to have been precipitated (lanes 3 and 4). vapa-q9wmx2_pro_0000037551-3 2867749 N/A 2867753 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2867755 unspecified role unspecified role prey prey Q9WMX2-PRO_0000037551:p.Ser232Ile mutation mutation certain certain sequence position certain certain certain sequence position certain false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 5C vapa-q9wmx2_pro_0000037551-4 2867749 N/A 2867754 inhibitor inhibitor prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2867753 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2867755 unspecified role unspecified role prey prey Q9WMX2-PRO_0000037551:p.Ser232Ile mutation mutation certain certain sequence position certain certain certain sequence position certain false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 5Ci In the presence of viperin, the level of immunoprecipitated myc–NS5A was markedly reduced. q9wmx2_pro_0000037551-rsad2-1 2867749 N/A 2867754 inhibitor inhibitor prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2867753 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2867755 unspecified role unspecified role bait bait Q9WMX2-PRO_0000037551:p.Ser232Ile mutation mutation certain certain sequence position certain certain certain sequence position certain false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 5C-RHS The level of immunoprecipitated FLAG–hVAP-33 in cells transfected with HA–viperin was greatly reduced. q9wmx2_pro_0000037551-vapa-2 2867749 N/A 2867753 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2867755 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q9WMX2-PRO_0000037551:p.Ser232Ile mutation mutation certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 5C-RHS rsad2-vapa-3 2867750 N/A 2867754 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2867753 unspecified role unspecified role neutral component neutral component n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false 2C, 3C rsad2-vapa-5 2867750 N/A 2867754 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 2867753 unspecified role unspecified role neutral component neutral component n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false 3E q9wmx2_pro_0000037551-rsad2-2 2867750 N/A 2867755 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component Q9WMX2-PRO_0000037551:p.Ser232Ile mutation mutation certain certain sequence position certain certain certain sequence position certain false N/A 2867754 inhibitor inhibitor neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2867753 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false 5E rsad2-vapa-2 2867751 N/A 2867753 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2867754 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2B rsad2-vapa-6 2867752 N/A 2867755 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component Q9WMX2-PRO_0000037551:p.Ser232Ile mutation mutation certain certain sequence position certain certain certain sequence position certain false N/A 2867754 inhibitor inhibitor neutral component neutral component N/A 2867753 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false 5D