IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ inforzato-2010-4 human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation inforzato-2010-6 in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation inforzato-2010-9 in vitro In vitro solid phase assay solid phase assay tag visualisation tag visualisation Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation inforzato-2010-3 human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f electrophoresis electrophoretic mobility-based method electrophoresis weight by comassie molecular weight estimation by coomasie staining weight by comassie Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation inforzato-2010-8 in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation inforzato-2010-10 in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom western blot western blot Immuno blot Immuno blot Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation inforzato-2010-1 crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation inforzato-2010-2 crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. saxs x ray scattering saxs predetermined predetermined participant predetermined Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation inforzato-2010-5 human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation inforzato-2010-7 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation inforzato-2010-11 human-8387 human fibrosarcoma cell line 8387 Human 8387 fibrosarcoma cell line 8387 electrophoresis electrophoretic mobility-based method electrophoresis weight by comassie molecular weight estimation by coomasie staining weight by comassie Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation inforzato-2010-12 human-8387 human fibrosarcoma cell line 8387 Human 8387 fibrosarcoma cell line 8387 molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation inforzato-2010-13 crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation inforzato-2010-14 human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation inforzato-2010-15 crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. tem transmission electron microscopy tem predetermined predetermined participant predetermined Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation inforzato-2010-16 human-8387 human fibrosarcoma cell line 8387 Human 8387 fibrosarcoma cell line 8387 tem transmission electron microscopy tem predetermined predetermined participant predetermined Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation inforzato-2010-17 crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. electrophoresis electrophoretic mobility-based method electrophoresis weight by comassie molecular weight estimation by coomasie staining weight by comassie Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ., Inforzato A., Baldock C., Jowitt TA., Holmes DF., Lindstedt R., Marcellini M., Rivieccio V., Briggs DC., Kadler KE., Verdoliva A., Bottazzi B., Mantovani A., Salvatori G., Day AJ. CHO_3.5 cells:-a clone of CHO cells selected with G418 (an aminoglycoside related to Gentamicin) producing high levels of PTX3. (pmid: 9407058) anthony.day@manchester.ac.uk The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation ptx3_human Pentraxin-related protein PTX3 Pentaxin-related protein PTX3 TNFAIP5 TSG14 Tumor necrosis factor alpha-induced protein 5 Tumor necrosis factor-inducible gene 14 protein PTX3 protein protein human Homo sapiens Human MHLLAILFCALWSAVLAENSDDYDLMYVNLDNEIDNGLHPTEDPTPCACGQEHSEWDKLFIMLENSQMRERMLLQATDDVLRGELQRLREELGRLAESLARPCAPGAPAEARLTSALDELLQATRDAGRRLARMEGAEAQRPEEAGRALAAVLEELRQTRADLHAVQGWAARSWLPAGCETAILFPMRSKKIFGSVHPVRPMRLESFSACIWVKATDVLNKTILFSYGTKRNPYEIQLYLSYQSIVFVVGGEENKLVAEAMVSLGRWTHLCGTWNSEEGLTSLWVNGELAATTVEMATGHIVPEGGILQIGQEKNGCCVGGGFDETLAFSGRLTGFNIWDSVLSNEEIRETGGAESCHIRGNIVGWGVTEIQPHGGAQYVS fgf2_human Fibroblast growth factor 2 Basic fibroblast growth factor FGF2 FGFB Heparin-binding growth factor 2 protein protein human Homo sapiens Human MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS ptx3-21 1937696 N/A 1937713 unspecified role unspecified role neutral component neutral component P26022:p.[Cys47Ser;Cys49Ser;Cys103Ser] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Stoichiometry: 2.0 direct interaction direct interaction false false false 5B Non-covalent associations between N_PTX3 monomers mediate dimerization. ptx3-18 1937696 N/A 1937713 unspecified role unspecified role neutral component neutral component c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P26022:p.Cys103Ser mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false P26022:p.[Cys47Ser;Cys49Ser] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 4.0 direct interaction direct interaction false false false 4Ci, 5B The single and double mutant proteins both corresponded to a mixture of tetramers and dimers ptx3-20 1937696 N/A 1937713 unspecified role unspecified role neutral component neutral component P26022:p.[Cys47Ser;Cys49Ser] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P26022:p.Cys103Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Stoichiometry: 2.0 direct interaction direct interaction false false false 5Bi 89yuih-1 1937697 N/A 1937714 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 N/A 1937713 unspecified role unspecified role neutral component neutral component crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. Stoichiometry: 1.0 direct interaction direct interaction false false false 7A, Supp 2B ptx3-24 1937697 N/A 1937713 unspecified role unspecified role neutral component neutral component c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f Stoichiometry: 2.0 direct interaction direct interaction false false false Supp 4 ptx3-25 1937697 N/A 1937713 unspecified role unspecified role neutral component neutral component c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f Stoichiometry: 4.0 direct interaction direct interaction false false false Supp 4 fgf2-ptx3-9 1937698 N/A 1937714 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) N/A 1937713 competitor competitor competitor prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false P26022:p.[Cys47Ser;Cys49Ser;Cys103Ser] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P26022:p.Cys103Ser mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f N/A 1937713 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction false false false 7Eii, Supp 7B fgf2-ptx3-10 1937698 N/A 1937714 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) N/A 1937713 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction false false false 7E fgf2-ptx3-11 1937698 N/A 1937713 competitor competitor competitor prey prey crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. N/A 1937714 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) N/A 1937713 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction false false false 7Ei ptx3-16 1937699 N/A 1937713 unspecified role unspecified role neutral component neutral component purified purified P26022:p.[Cys47Ser;Cys49Ser;Cys103Ser] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Stoichiometry: 2.0 direct interaction direct interaction false false false 4B, 5A The C_PTX3 fragment does not oligomerise. ptx3-17 1937699 N/A 1937713 unspecified role unspecified role neutral component neutral component purified purified P26022:p.Cys103Ser mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false P26022:p.[Cys47Ser;Cys49Ser] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Stoichiometry: 4.0 direct interaction direct interaction false false false 4Bi, 5A The C_PTX3 fragment does not oligomerise. 243-1 1937700 N/A 1937714 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) N/A 1937713 unspecified role unspecified role prey prey crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction false false false 7D fgf2-ptx3-7 1937700 N/A 1937714 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) N/A 1937713 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false P26022:p.Cys103Ser mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false P26022:p.[Cys47Ser;Cys49Ser;Cys103Ser] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f direct interaction direct interaction false false false 7Di, Supp 7A fgf2-ptx3-12 1937701 N/A 1937714 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 1937713 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f Stoichiometry: 2.0 direct interaction direct interaction false false false 7F Both the disulfide-linked tetramer (4-mer) and disulfide-linked dimer (2-mer), bound to bFGF2 fgf2-ptx3-14 1937701 N/A 1937714 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 1937713 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f Stoichiometry: 4.0 direct interaction direct interaction false false false 7F Both the disulfide-linked tetramer (4-mer) and disulfide-linked dimer (2-mer), bound to bFGF2 ptx3-26 1937702 N/A 1937713 unspecified role unspecified role neutral component neutral component Stoichiometry: 8.0 direct interaction direct interaction false false false 1 Material isolated from a much smaller peak indicated that this species is composed of 16 promoter subunits. ptx3-15 1937703 N/A 1937713 unspecified role unspecified role neutral component neutral component crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. Stoichiometry: 8.0 direct interaction direct interaction false false false 3 The protein is composed of four globular domains (each with a diameter of ∼4 nm) arranged into tetramers. ptx3-19 1937704 N/A 1937713 unspecified role unspecified role neutral component neutral component P26022:p.Cys103Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false P26022:p.[Cys47Ser;Cys49Ser] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Stoichiometry: 2.0 direct interaction direct interaction false false false 5C fgf2-ptx3-8 1937705 N/A 1937714 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 1937713 unspecified role unspecified role neutral component neutral component crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. Stoichiometry: 2.0 direct interaction direct interaction false false false 7B ptx3-22 1937706 N/A 1937713 unspecified role unspecified role neutral component neutral component Stoichiometry: 8.0 physical association physical association false false false Supp 3A Stoichiometry has been inferred by similarity to the purified recombinant protein. ptx3-23 1937707 N/A 1937713 unspecified role unspecified role neutral component neutral component Stoichiometry: 8.0 physical association physical association false false false Supp 3B Stoichiometry has been inferred by similarity to the purified recombinant protein. fgf2-ptx3-13 1937708 N/A 1937713 unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 8.0 direct interaction direct interaction false false false Supp 2A ptx3-28 1937709 N/A 1937713 unspecified role unspecified role neutral component neutral component purified purified c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Stoichiometry: 4.0 direct interaction direct interaction false false false Supp 2A The C_PTX3 fragment does not oligomerise. ptx3-27 1937710 N/A 1937713 unspecified role unspecified role neutral component neutral component N/A 1937713 unspecified role unspecified role neutral component neutral component direct interaction direct interaction false false false 2 The protein is composed of four globular domains arranged into tetramers. ptx3-ptx3-1 1937711 N/A 1937713 unspecified role unspecified role neutral component neutral component N/A 1937713 unspecified role unspecified role neutral component neutral component direct interaction direct interaction false false false Supp fig 3 C/D The protein is composed of four globular domains arranged into tetramers. 5qsdf-1 1937712 N/A 1937713 unspecified role unspecified role neutral component neutral component purified purified N/A 1937713 unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false 4B Molecular weight was greater than 210kDa.