IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ bosanac-2009-4 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Bosanac I., Maun HR., Scales SJ., Wen X., Lingel A., Bazan JF., de Sauvage FJ., Hymowitz SG., Lazarus RA., Bosanac I., Maun HR., Scales SJ., Wen X., Lingel A., Bazan JF., de Sauvage FJ., Hymowitz SG., Lazarus RA. sauvage@gene.com,hymowitz@gene.com,laz@gene.com Nature structural & molecular biology 2009 Only protein-protein interactions imex curation imex curation bosanac-2009-3 in vitro In vitro solid phase assay solid phase assay tag visualisation tag visualisation Bosanac I., Maun HR., Scales SJ., Wen X., Lingel A., Bazan JF., de Sauvage FJ., Hymowitz SG., Lazarus RA., Bosanac I., Maun HR., Scales SJ., Wen X., Lingel A., Bazan JF., de Sauvage FJ., Hymowitz SG., Lazarus RA. Plates were coated with HHIP and dilutions of either DHH, IHH or SHH plus biotinylated-SHH were added. Streptavidin-HRP was added, wells washed, HRP substrate added and colour/OD measured. sauvage@gene.com,hymowitz@gene.com,laz@gene.com Nature structural & molecular biology 2009 Only protein-protein interactions imex curation imex curation bosanac-2009-2 in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Bosanac I., Maun HR., Scales SJ., Wen X., Lingel A., Bazan JF., de Sauvage FJ., Hymowitz SG., Lazarus RA., Bosanac I., Maun HR., Scales SJ., Wen X., Lingel A., Bazan JF., de Sauvage FJ., Hymowitz SG., Lazarus RA. sauvage@gene.com,hymowitz@gene.com,laz@gene.com Nature structural & molecular biology 2009 Only protein-protein interactions imex curation imex curation bosanac-2009-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Bosanac I., Maun HR., Scales SJ., Wen X., Lingel A., Bazan JF., de Sauvage FJ., Hymowitz SG., Lazarus RA., Bosanac I., Maun HR., Scales SJ., Wen X., Lingel A., Bazan JF., de Sauvage FJ., Hymowitz SG., Lazarus RA. sauvage@gene.com,hymowitz@gene.com,laz@gene.com Nature structural & molecular biology 2009 Only protein-protein interactions imex curation imex curation bosanac-2009-5 in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Bosanac I., Maun HR., Scales SJ., Wen X., Lingel A., Bazan JF., de Sauvage FJ., Hymowitz SG., Lazarus RA., Bosanac I., Maun HR., Scales SJ., Wen X., Lingel A., Bazan JF., de Sauvage FJ., Hymowitz SG., Lazarus RA. sauvage@gene.com,hymowitz@gene.com,laz@gene.com Nature structural & molecular biology 2009 Only protein-protein interactions imex curation imex curation shh_human Sonic hedgehog protein Shh unprocessed N-terminal signaling and C-terminal autoprocessing domains SHH HHG-1 protein protein human Homo sapiens Human MLLLARCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLSPGDRVLAADDQGRLLYSDFLTFLDRDDGAKKVFYVIETREPRERLLLTAAHLLFVAPHNDSATGEPEASSGSGPPSGGALGPRALFASRVRPGQRVYVVAERDGDRRLLPAAVHSVTLSEEAAGAYAPLTAQGTILINRVLASCYAVIEEHSWAHRAFAPFRLAHALLAALAPARTDRGGDSGGGDRGGGGGRVALTAPGAADAPGAGATAGIHWYSQLLYQIGTWLLDSEALHPLGMAVKSS hhip_human Hedgehog-interacting protein HHIP HIP UNQ5825/PRO19644 protein protein human Homo sapiens Human MLKMLSFKLLLLAVALGFFEGDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLELLSGGEMLCGGFYPRLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQSLFHSPEREVLERDLVLPLLCKDYCKEFFYTCRGHIPGFLQTTADEFCFYYARKDGGLCFPDFPRKQVRGPASNYLDQMEEYDKVEEISRKHKHNCFCIQEVVSGLRQPVGALHSGDGSQRLFILEKEGYVKILTPEGEIFKEPYLDIHKLVQSGIKGGDERGLLSLAFHPNYKKNGKLYVSYTTNQERWAIGPHDHILRVVEYTVSRKNPHQVDLRTARVFLEVAELHRKHLGGQLLFGPDGFLYIILGDGMITLDDMEEMDGLSDFTGSVLRLDVDTDMCNVPYSIPRSNPHFNSTNQPPEVFAHGLHDPGRCAVDRHPTDININLTILCSDSNGKNRSSARILQIIKGKDYESEPSLLEFKPFSNGPLVGGFVYRGCQSERLYGSYVFGDRNGNFLTLQQSPVTKQWQEKPLCLGTSGSCRGYFSGHILGFGEDELGEVYILSSSKSMTQTHNGKLYKIVDPKRPLMPEECRATVQPAQTLTSECSRLCRNGYCTPTGKCCCSPGWEGDFCRTAKCEPACRHGGVCVRPNKCLCKKGYLGPQCEQVDRNIRRVTRAGILDQIIDMTSYLLDLTSYIV ptc1_human Protein patched homolog 1 PTCH1 PTCH protein protein human Homo sapiens Human MASAGNAAEPQDRGGGGSGCIGAPGRPAGGGRRRRTGGLRRAAAPDRDYLHRPSYCDAAFALEQISKGKATGRKAPLWLRAKFQRLLFKLGCYIQKNCGKFLVVGLLIFGAFAVGLKAANLETNVEELWVEVGGRVSRELNYTRQKIGEEAMFNPQLMIQTPKEEGANVLTTEALLQHLDSALQASRVHVYMYNRQWKLEHLCYKSGELITETGYMDQIIEYLYPCLIITPLDCFWEGAKLQSGTAYLLGKPPLRWTNFDPLEFLEELKKINYQVDSWEEMLNKAEVGHGYMDRPCLNPADPDCPATAPNKNSTKPLDMALVLNGGCHGLSRKYMHWQEELIVGGTVKNSTGKLVSAHALQTMFQLMTPKQMYEHFKGYEYVSHINWNEDKAAAILEAWQRTYVEVVHQSVAQNSTQKVLSFTTTTLDDILKSFSDVSVIRVASGYLLMLAYACLTMLRWDCSKSQGAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQNKRIPFEDRTGECLKRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRLDIFCCFTSPCVSRVIQVEPQAYTDTHDNTRYSPPPPYSSHSFAHETQITMQSTVQLRTEYDPHTHVYYTTAEPRSEISVQPVTVTQDTLSCQSPESTSSTRDLLSQFSDSSLHCLEPPCTKWTLSSFAEKHYAPFLLKPKAKVVVIFLFLGLLGVSLYGTTRVRDGLDLTDIVPRETREYDFIAAQFKYFSFYNMYIVTQKADYPNIQHLLYDLHRSFSNVKYVMLEENKQLPKMWLHYFRDWLQGLQDAFDSDWETGKIMPNNYKNGSDDGVLAYKLLVQTGSRDKPIDISQLTKQRLVDADGIINPSAFYIYLTAWVSNDPVAYAASQANIRPHRPEWVHDKADYMPETRLRIPAAEPIEYAQFPFYLNGLRDTSDFVEAIEKVRTICSNYTSLGLSSYPNGYPFLFWEQYIGLRHWLLLFISVVLACTFLVCAVFLLNPWTAGIIVMVLALMTVELFGMMGLIGIKLSAVPVVILIASVGIGVEFTVHVALAFLTAIGDKNRRAVLALEHMFAPVLDGAVSTLLGVLMLAGSEFDFIVRYFFAVLAILTILGVLNGLVLLPVLLSFFGPYPEVSPANGLNRLPTPSPEPPPSVVRFAMPPGHTHSGSDSSDSEYSSQTTVSGLSEELRHYEAQQGAGGPAHQVIVEATENPVFAHSTVVHPESRHHPPSNPRQQPHLDSGSLPPGRQGQQPRRDPPREGLWPPPYRPRRDAFEISTEGHSGPSNRARWGPRGARSHNPRNPASTAMGSSVPGYCQPITTVTASASVTVAVHPPPVPGPGRNPRGGLCPGYPETDHGLFEDPHVPFHVRCERRDSKVEVIELQDVECEERPRGSSSN dhh_human Desert hedgehog protein HHG-3 DHH protein protein human Homo sapiens Human MALLTNLLPLCCLALLALPAQSCGPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHVHVSVKADNSLAVRAGGCFPGNATVRLWSGERKGLRELHRGDWVLAADASGRVVPTPVLLFLDRDLQRRASFVAVETEWPPRKLLLTPWHLVFAARGPAPAPGDFAPVFARRLRAGDSVLAPGGDALRPARVARVAREEAVGVFAPLTAHGTLLVNDVLASCYAVLESHQWAHRAFAPLRLLHALGALLPGGAVQPTGMHWYSRLLYRLAEELLG ihh_human Indian hedgehog protein IHH HHG-2 protein protein human Homo sapiens Human MSPARLRPRLHFCLVLLLLLVVPAAWGCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYESKAHVHCSVKSEHSAAAKTGGCFPAGAQVRLESGARVALSAVRPGDRVLAMGEDGSPTFSDVLIFLDREPHRLRAFQVIETQDPPRRLALTPAHLLFTADNHTEPAARFRATFASHVQPGQYVLVAGVPGLQPARVAAVSTHVALGAYAPLTKHGTLVVEDVVASCFAAVADHHLAQLAFWPLRLFHSLAWGSWTPGEGVHWYPQLLYRLGRLLLEEGSFHPLGMSGAGS calcium(2+) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) zinc(2+) zinc(2+) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) shh-hhip-5 1923919 N/A 1923924 unspecified role unspecified role neutral component neutral component zn_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region 13c label 13c label C13 13C C13 13C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 1923925 unspecified role unspecified role neutral component neutral component region_l2_peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q96QV1:p.[Asp371Cys;Thr389Cys] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false 1923936 1923933 direct interaction direct interaction false false false 4C shh-hhip-3 1923919 N/A 1923926 unspecified role unspecified role neutral component neutral component region_l2_like_peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q13635:p.[Ile899_Ser900delinsGlyCys;Ser917_Ala918delinsCysGly] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false N/A 1923924 unspecified role unspecified role neutral component neutral component region 13c label 13c label C13 13C C13 13C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false zn_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) 1923944 1923940 direct interaction direct interaction false false false 4D ptch1-shh-1 1923919 N/A 1923924 unspecified role unspecified role neutral component neutral component region 13c label 13c label C13 13C C13 13C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false zn_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1923925 competitor competitor competitor neutral component neutral component region_l2_peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q96QV1:p.[Asp371Cys;Thr389Cys] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false N/A 1923926 unspecified role unspecified role neutral component neutral component region_l2_like_peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q13635:p.[Ile899_Ser900delinsGlyCys;Ser917_Ala918delinsCysGly] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false 1923951 1923948 1923953 1923948 physical association physical association false false false 4E hhip-shh-5 1923919 N/A 1923924 unspecified role unspecified role neutral component neutral component zn_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 1923925 unspecified role unspecified role neutral component neutral component region_l2_peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q96QV1:p.[Asp371Cys;Thr389Cys] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false 1923960 1923957 direct interaction direct interaction false false false Supp 6A ptch1-shh-2 1923919 N/A 1923926 unspecified role unspecified role neutral component neutral component region_l2_like_peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q13635:p.[Ile899_Ser900delinsGlyCys;Ser917_Ala918delinsCysGly] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false N/A 1923924 unspecified role unspecified role neutral component neutral component region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false zn_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) 1923968 1923964 direct interaction direct interaction false false false Supp 6A shh-hhip-4 1923920 N/A 1923924 unspecified role unspecified role prey prey n_terminus biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false zn_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 1923925 unspecified role unspecified role bait bait c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false beta_propeller_and_egf_domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper 1923976 1923972 direct interaction direct interaction false false false Supp 7B Antibody "5E1" (a high-affinity anti-Shh monoclonal antibody) competes for SHH binding hhip-shh-2 1923920 N/A 1923925 unspecified role unspecified role bait bait c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false beta_propeller_and_egf_domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 1923924 unspecified role unspecified role prey prey n_terminus biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false zn_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 1923924 competitor competitor competitor prey prey zn_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false 1923920 Supp 1Ai hhip-shh-3 1923920 N/A 1923925 unspecified role unspecified role bait bait beta_propeller_and_egf_domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 1923924 unspecified role unspecified role prey prey n_terminus biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false zn_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 1923927 competitor competitor competitor prey prey zn_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false 1923920 Supp 1Aii hhip-dhh-1 1923920 N/A 1923925 unspecified role unspecified role bait bait beta_propeller_and_egf_domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 1923924 unspecified role unspecified role prey prey n_terminus biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false zn_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 1923928 competitor competitor competitor prey prey zn_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false 1923920 Supp 1Aiii shh-hhip-1 1923921 N/A 1923924 unspecified role unspecified role bait bait zn_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) N/A 1923925 unspecified role unspecified role prey prey beta_propeller_and_egf_domain_1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false trini Trichoplusia ni (Cabbage looper) Cabbage looper 1924015 1924012 direct interaction direct interaction false false false 3C shh-hhip-2 1923921 N/A 1923925 competitor competitor competitor unspecified role unspecified role region_l2_peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 1923924 unspecified role unspecified role bait bait zn_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) N/A 1923925 unspecified role unspecified role prey prey beta_propeller_and_egf_domain_1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false 1923921 3Ci hhip-shh-1 1923922 N/A 1923929 unspecified role unspecified role neutral component neutral component N/A 1923924 unspecified role unspecified role neutral component neutral component zn_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 1923930 cofactor cofactor coenzyme neutral component neutral component N/A 1923925 unspecified role unspecified role neutral component neutral component beta_propeller_and_egf_domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false trini Trichoplusia ni (Cabbage looper) Cabbage looper Stoichiometry: 1.0 1924032 1924029 direct interaction direct interaction false false false Table 1 3.0A R work 0.231 R Free 0.287 hhip-shh-4 1923923 N/A 1923925 unspecified role unspecified role bait bait beta_propeller_and_egf_domain_1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 1923924 unspecified role unspecified role prey prey n_terminus biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false zn_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) 1924039 1924036 direct interaction direct interaction false false false 1923923 Supp 4 EDTA