UniProt UniProt http://www.uniprot.org arsenijevic-2006-1 crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Arsenijevic T., Degraef C., Dumont JE., Roger PP., Pirson I. tarsenij@ulb.ac.be Cell cycle (Georgetown, Tex.) 2006 Only protein-protein interactions imex curation imex curation arsenijevic-2006-2 crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Arsenijevic T., Degraef C., Dumont JE., Roger PP., Pirson I. tarsenij@ulb.ac.be Cell cycle (Georgetown, Tex.) 2006 Only protein-protein interactions imex curation imex curation arsenijevic-2006-3 crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Arsenijevic T., Degraef C., Dumont JE., Roger PP., Pirson I. tarsenij@ulb.ac.be Cell cycle (Georgetown, Tex.) 2006 Only protein-protein interactions imex curation imex curation ccne1_human G1/S-specific cyclin-E1 CCNE1 CCNE protein protein human Homo sapiens Human MPRERRERDAKERDTMKEDGGAEFSARSRKRKANVTVFLQDPDEEMAKIDRTARDQCGSQPWDNNAVCADPCSLIPTPDKEDDDRVYPNSTCKPRIIAPSRGSPLPVLSWANREEVWKIMLNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWRLSPLTIVSWLNVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILAASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNIQTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSGKKQSSGPEMA akap8_canlf A-kinase anchor protein 8 AKAP8 AKAP95 A-kinase anchor protein 95 kDa protein protein canlf Canis familiaris (dog) Canis lupus familiaris Dog Canis familiaris MEQGYGGYGAWSAGPTNTQGAYGTGVASWQGYENYNYYGAQNTSVTTGASYSYGPASWETTKASDSLGAGGPAVHMASYGPEPCTDNSDSLIAKINQRLDMMSKEGGRGGSSGGGEGMQDRESSFRFQSYESYDSRSCLPEHHPYRPSYSYDYDFDPMPDRNGGFSSQYGDCRDPARERGSLDGFMRGRGQGQGQGRFQDRSNPSTFMRSDPFMPPSASSEPLSAPWPELNYVGGRGLGGPSPSRPPPSLFSQSMAPDFGVMGMQGAGGYDNSVPYGCGRSQTRMRDRPRRRGFDRCGPDGMGRKRKQLQIYDEPDAKLARADSEGDFSENDDGAADFRSGDEEFRGEDEFFDPGRQRGEKDDEDDEVKKRREKQRRRDRMRDRAADRIQFACSVCKFRSFEDEEIQKHLQSKFHKETLRFISTKLPDKTVEFLQEYIVNRNKKIEKRRQELMEKESTKPKPDPFKGIGQEHFFKKIEAAHCLACDMLIPAQHQLLQRHLHSVDHNHNRRLAAEQFKKTSLHVARSVLNNRHIVKMLEKYLKGEDPFTSEAVDPEIEGDDTLGGEKEETPEEVAAEVLAEVITAAVRAVDGEGAPAPEGSDTPPEGQGPVDTAEATHSPHSEQLVEVETPCGAAPEKGDANAEAGGETTEAAGEEQEVVAKTDGAVDGTVRGAAPAPPVTETKAEQTEAEPKDVTPTE ccnd3_human G1/S-specific cyclin-D3 CCND3 protein protein human Homo sapiens Human MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL kap2_human cAMP-dependent protein kinase type II-alpha regulatory subunit PKR2 PRKAR2 PRKAR2A protein protein human Homo sapiens Human MSHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARAPASVLPAATPRQSLGHPPPEPGPDRVADAKGDSESEEDEDLEVPVPSRFNRRVSVCAETYNPDEEEEDTDPRVIHPKTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFERIVKADEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQYDNRGSFGELALMYNTPRAATIVATSEGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLLKSLEVSERMKIVDVIGEKIYKDGERIITQGEKADSFYIIESGEVSILIRSRTKSNKDGGNQEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGSSVDLGNLGQ akap8-ccne1-1 1931592 N/A 1931595 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1931596 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1 and 2B CDK2 (co-transfected CDK2 Uniprot P24941) akap8-ccnd3-3 1931592 N/A 1931597 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1931596 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2A CDK4 (co-transfected HA-CDK4 Uniprot P11802) ccnd3-akap8-4 1931592 N/A 1931597 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1931596 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 4 Association is independent of cAMP TSH stimulation (TSH receptor cotransfected) prkar2a-ccnd3-1 1931593 N/A 1931596 stimulator stimulator ancillary ancillary nucl transfection nucleic acid transfection nucl transfection region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1931598 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1931597 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3A ccne1-prkar2a-1 1931594 N/A 1931598 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1931595 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1931596 stimulator stimulator ancillary ancillary nucl transfection nucleic acid transfection nucl transfection region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3B CDK2 (co-transfected CDK2 Uniprot P24941)