UniProt UniProt http://www.uniprot.org kamada-2005-2 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Kamada S., Kikkawa U., Tsujimoto Y., Hunter T. Origin of CASP3 according PMID 9671712 skamada@kobe-u.ac.jp Molecular and cellular biology 2005 Only protein-protein interactions imex curation imex curation kamada-2005-3 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kamada S., Kikkawa U., Tsujimoto Y., Hunter T. Origin of CASP3 according PMID 9671712 skamada@kobe-u.ac.jp Molecular and cellular biology 2005 Only protein-protein interactions imex curation imex curation kamada-2005-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kamada S., Kikkawa U., Tsujimoto Y., Hunter T. The transfected bait vector contains sequences of CASP3 p12 and CASP p17, both with separate promoters for expression in yeast Origin of CASP3 according PMID 9671712 skamada@kobe-u.ac.jp Molecular and cellular biology 2005 Only protein-protein interactions imex curation imex curation kamada-2005-4 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kamada S., Kikkawa U., Tsujimoto Y., Hunter T. Origin of CASP3 according PMID 9671712 skamada@kobe-u.ac.jp Molecular and cellular biology 2005 Only protein-protein interactions imex curation imex curation kamada-2005-5 human-hep2 Homo sapiens hep2 hep2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kamada S., Kikkawa U., Tsujimoto Y., Hunter T. Origin of CASP3 according PMID 9671712 skamada@kobe-u.ac.jp Molecular and cellular biology 2005 Only protein-protein interactions imex curation imex curation kamada-2005-6 human-hep2 Homo sapiens hep2 hep2 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Kamada S., Kikkawa U., Tsujimoto Y., Hunter T. Origin of CASP3 according PMID 9671712 skamada@kobe-u.ac.jp Molecular and cellular biology 2005 Only protein-protein interactions imex curation imex curation akap8_human A-kinase anchor protein 8 AKAP8 AKAP95 A-kinase anchor protein 95 kDa protein protein human Homo sapiens Human MDQGYGGYGAWSAGPANTQGAYGTGVASWQGYENYNYYGAQNTSVTTGATYSYGPASWEAAKANDGGLAAGAPAMHMASYGPEPCTDNSDSLIAKINQRLDMMSKEGGRGGSGGGGEGIQDRESSFRFQPFESYDSRPCLPEHNPYRPSYSYDYEFDLGSDRNGSFGGQYSECRDPARERGSLDGFMRGRGQGRFQDRSNPGTFMRSDPFVPPAASSEPLSTPWNELNYVGGRGLGGPSPSRPPPSLFSQSMAPDYGVMGMQGAGGYDSTMPYGCGRSQPRMRDRDRPKRRGFDRFGPDGTGRKRKQFQLYEEPDTKLARVDSEGDFSENDDAAGDFRSGDEEFKGEDELCDSGRQRGEKEDEDEDVKKRREKQRRRDRTRDRAADRIQFACSVCKFRSFDDEEIQKHLQSKFHKETLRFISTKLPDKTVEFLQEYIVNRNKKIEKRRQELMEKETAKPKPDPFKGIGQEHFFKKIEAAHCLACDMLIPAQPQLLQRHLHSVDHNHNRRLAAEQFKKTSLHVAKSVLNNRHIVKMLEKYLKGEDPFTSETVDPEMEGDDNLGGEDKKETPEEVAADVLAEVITAAVRAVDGEGAPAPESSGEPAEDEGPTDTAEAGSDPQAEQLLEEQVPCGTAHEKGVPKARSEAAEAGNGAETMAAEAESAQTRVAPAPAAADAEVEQTDAESKDAVPTE p42574-pro_0000004572 Caspase-3 subunit p12 CASP3 CPP32 Apopain Cysteine protease CPP32 Protein Yama SREBP cleavage activity 1 protein protein human Homo sapiens Human SGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH 176 277 p42574-pro_0000004571 Caspase-3 subunit p17 CASP3 CPP32 Apopain Cysteine protease CPP32 Protein Yama SREBP cleavage activity 1 protein protein human Homo sapiens Human SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETD 29 175 casp3_human Caspase-3 Apopain Cysteine protease CPP32 Protein Yama SREBP cleavage activity 1 CASP3 CPP32 protein protein human Homo sapiens Human MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH akap8_mouse A-kinase anchor protein 8 Akap8 Akap95 A-kinase anchor protein 95 kDa protein protein mouse Mus musculus Mouse MEQGYGGYGAWSAGPANTQGTYGSGMTSWQGYENYNYYNAQNTSVPAGTPYSYGPASWEATKTNDGGLAAGSPAMHVASFAPEPCTDNSDSLIAKINQRLDMLSKEGGRGGISSGGEGVQDRDSSFRFQPYESYDARPCIPEHNPYRPGYGYDYDFDLGTDRNGSFGGTFNDCRDPAPERGSLDGFLRGRGQGRFQDRSNSSTFIRSDPFMPPSASEPLSTTWNELNYMGGRGLGGPSTSRPPPSLFSQSMAPDYSMMGMQGVGGFGGTMPYGCGRSQTRIRDWPRRRGFERFGPDNMGRKRKQFPLYEEPDAKLARADSDGDLSENDDGAGDLRSGDEEFRGEDDLCDSRKQRGEKEDEDEDVKKRREKQRRRDRMRDRAADRIQFACSVCKFRSFEDEEIQKHLQSKFHKETLRFISTKLPDKTVEFLQEYIINRNKKIEKRRQELLEKESPKPKPDPFKGIGQEHFFKKIEAAHCLACDMLIPAQHQLLQRHLHSVDHNHNRRLAAEQFKKTSLHVAKSVLNNKHIVKMLEKYLKGEDPFVNETADLETEGDENVGEEKEETPEEVAAEVLAEVITAAVKAVEGEGEPAAAHSDVLTEVEGPVDTAEASSDPHTEKLLEEQTCEAASETRSIEDKTRGEAAEARNEAAMPTADAGSTLPVIAIPGIMEDELEQTGAEAKDIPTE akap8-casp3-2 1923822 N/A 1923828 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection N/A 1923829 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false derived from transfected casp3-Wt-GFP physical association physical association false false false 3A akap8-casp3-1 1923822 N/A 1923830 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false derived from transfected GFP-(delta)pro-casp3-wt N/A 1923828 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection physical association physical association false false false 3A akap8-casp3-3 1923822 N/A 1923828 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection N/A 1923831 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 3B akap8-casp3-5 1923823 N/A 1923828 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection N/A 1923831 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection physical association physical association false false false 3B akap8-casp3-6 1923823 N/A 1923831 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection dsred fusion protein fusion protein c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 1923828 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection physical association physical association false false false 3B casp3-akap8-1 1923824 N/A 1923830 unspecified role unspecified role ancillary ancillary P42574-PRO_0000004571:p.Cys135Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false N/A 1923829 unspecified role unspecified role bait bait P42574-PRO_0000004572:p.Arg32Glu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false N/A 1923832 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9DBR0:p.Glu675Gly mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false Q9DBR0:p.Thr677Gly mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 1 casp3-akap8-2 1923825 N/A 1923828 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n-terminus xpress tag xpress tag anti tag western anti tag western blot anti tag western n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 1923831 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 3C akap8-casp3-4 1923826 N/A 1923828 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection N/A 1923831 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection physical association physical association false false false 3D A low level (<1%) of procaspase 3 coprecipitating with AKAP95 in the supernatant fraction was detected. akap8-casp3-7 1923827 N/A 1923829 unspecified role unspecified role neutral component neutral component N/A 1923828 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection colocalization colocalization false false false 4B right Observed in apoptotic cells