IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ alexandrov-2002-1 in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Alexandrov A., Martzen MR., Phizicky EM. eric_phizicky@urmc.rochester.edu RNA (New York, N.Y.) 2002 imex curation Only protein-protein interactions imex curation alexandrov-2002-2 yeast Saccharomyces cerevisiae Baker's yeast affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom anti tag western anti tag western blot anti tag western Alexandrov A., Martzen MR., Phizicky EM. eric_phizicky@urmc.rochester.edu RNA (New York, N.Y.) 2002 imex curation Only protein-protein interactions imex curation trna phe gaa precursor trna Phe GAA precursor trna transfer rna transfer ribonucleic acid tRNA transfer RNA trna yeast Saccharomyces cerevisiae Baker's yeast GCGGACUUAGCUCAGUUGGGAGAGCGCCAGACUGAAGAAAAACUUCGGUCAAGUCAUCUGGAGGUCCUGUGUUCGAUCCACAGAGUUCGCA trm82_yeast tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit TRM82 TRM82 YDR165W YD8358.19 Transfer RNA methyltransferase 82 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSVIHPLQNLLTSRDGSLVFAIIKNCILSFKYQSPNHWEFAGKWSDDFDKIQESRNTTAKEQQGQSSENENENKKLKSNKGDSIKRTAAKVPSPGLGAPPIYSYIRNLRLTSDESRLIACADSDKSLLVFDVDKTSKNVLKLRKRFCFSKRPNAISIAEDDTTVIIADKFGDVYSIDINSIPEEKFTQEPILGHVSMLTDVHLIKDSDGHQFIITSDRDEHIKISHYPQCFIVDKWLFGHKHFVSSICCGKDYLLLSAGGDDKIFAWDWKTGKNLSTFDYNSLIKPYLNDQHLAPPRFQNENNDIIEFAVSKIIKSKNLPFVAFFVEATKCIIILEMSEKQKGDLALKQIITFPYNVISLSAHNDEFQVTLDNKESSGVQKNFAKFIEYNLNENSFVVNNEKSNEFDSAIIQSVQGDSNLVTKKEEIYPLYNVSSLRKHGEHYS F1E0847F44376969 trmb_yeast tRNA (guanine-N(7)-)-methyltransferase tRNA (guanine(46)-N(7))-methyltransferase TRM8 YDL201W D1075 tRNA(m7G46)-methyltransferase Transfer RNA methyltransferase 8 protein protein yeast Saccharomyces cerevisiae Baker's yeast MKAKPLSQDPGSKRYAYRINKEENRKELKHVKINESSLVQEGQKIDLPKKRYYRQRAHSNPFSDHQLEYPVSPQDMDWSKLYPYYKNAENGQMTKKVTIADIGCGFGGLMIDLSPAFPEDLILGMEIRVQVTNYVEDRIIALRNNTASKHGFQNINVLRGNAMKFLPNFFEKGQLSKMFFCFPDPHFKQRKHKARIITNTLLSEYAYVLKEGGVVYTITDVKDLHEWMVKHLEEHPLFERLSKEWEENDECVKIMRNATEEGKKVERKKGDKFVACFTRLPTPAIL 0280B9A7B02C85B7 trm8 trm82 trnaphe-1 2857327 N/A 2857329 enzyme target enzyme target substrate substrate neutral component neutral component label 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false G 7 methylation rna chemical modification RNA chemical modification RNA chemical modification post-transcriptional modification rna chemical modification undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false the mod position is identified in Fig 8 in vitro In vitro N/A 2857330 enzyme regulator enzyme regulator neutral component neutral component his mbp tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 2857331 enzyme enzyme neutral component neutral component his map tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) methylation methylation reaction methylation false false false Fig 7 B s_adenosyl_l_methionine-trm8-1 2857327 N/A 2857329 enzyme target enzyme target substrate substrate neutral component neutral component G 7 methylation rna chemical modification RNA chemical modification RNA chemical modification post-transcriptional modification rna chemical modification certain certain sequence position certain certain certain sequence position certain false the mod position is identified in Fig 8 3-prime C p32 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain false in vitro In vitro To identify the methylated position, the RNA was subjected to borohydride reduction followed by aniline cleavage of the RNA N/A 2857330 enzyme regulator enzyme regulator neutral component neutral component his mbp tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 2857331 enzyme enzyme neutral component neutral component his mbp tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) methylation methylation reaction methylation false false false Fig 8 trm8-trm82-3 2857328 N/A 2857330 unspecified role unspecified role prey prey tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 2857331 unspecified role unspecified role bait bait ha zz tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig 9