IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ bagni-1998-1 in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom autoradiography autoradiography Bagni C., Lapeyre B. lapeyre@jones.igm.cnrs-mop.fr The Journal of biological chemistry 1998 imex curation Only protein-protein interactions imex curation gar1_yeast H/ACA ribonucleoprotein complex subunit GAR1 YHR089C GAR1 snoRNP protein GAR1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSFRGGNRGGRGGFRGGFRGGRTGSARSFQQGPPDTVLEMGAFLHPCEGDIVCRSINTKIPYFNAPIYLENKTQVGKVDEILGPLNEVFFTIKCGDGVQATSFKEGDKFYIAADKLLPIERFLPKPKVVGPPKPKNKKKRSGAPGGRGGASMGRGGSRGGFRGGRGGSSFRGGRGGSSFRGGSRGGSFRGGSRGGSRGGFRGGRR C197FE85644DD0F8 snr10_yeast_rna small nucleolar RNA 10 Yeast snorna small nucleolar rna snoRNA snorna yeast Saccharomyces cerevisiae Baker's yeast AACGCAAAUUUAACAGCCAUUCGUAACACGUACAGUAUCUCGUCGAGGUUGAACCCCUCCGGGGCGUUCUUGACCCAUGAAGAAUGUGGAUUGGUGUUGCAAUAUAUUUAUUAUUGGCUUGGACUGGAGAACAAAUUUAUCGAUCUUGGGUGCAACAGUCUUUCUGUCGUCUGUUUUUUAGCAGAUCUAAGGGUUUACCUUCGUGUGCCCGGAUGAGGACCGUUGCAAGGAUUGAUAAUACAACU snr30_yeast_rna small nuclear RNA 30 Yeast snorna small nucleolar rna snoRNA snorna yeast Saccharomyces cerevisiae Baker's yeast AACCAUAGUCUCGUGCUAGUUCGGUACUAUACAGGGAAGGGAAGUCACUCGCAUACGUGUGUGUGCAUUUCUUGCUAUUGCUGCUUAGCUUCUCUAAAACACUGGGCUAGCGUUUUUCAACGCUCGAGAGGCAGAGUCUCAAGGAGCCUCCAAUGGGCCUCACGUAUUCAUCUAGAUGGCGCUUCGGACAACGGCAUCACAUAAGAGAUGCAGCUCCUGACUUCUCCUCUGAUCUUCGUGAUCAGAGUUUUGAGUCGUCAGACUACGAGCAGUUUCUCUUAGUCGUUGCAUCGGGUGCUGUUGCCUUAACGAUGUGUAUAUGGGGUUCGGGGGCUGUUGCCAUGAUAUAUAUGGAUGAGACAGAAGUGGCCCCGUUGACGAGUUUAACUUAGAUUAAGUAGGACGCAUGAUCUUGAGCUCUUUUCCUAUACUUUGUCCUAUGGCCAGCUUUCUCCUUAUUACGAAGAGAUUGCGGGAUGUGGGUGCAGAGUGGGAAAAUCUGAGUUCGGUCAUCUUUGUUGUUCGUCCUACCGCAGUAUAUUCCUAAACACUAUGAAAUGACCCUAGUUGGUCCAUGAUCAUUUGGGUAAAACCAUACUGCAGACA gar1p_snr10-1 1858961 N/A 1858962 unspecified role unspecified role prey prey label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 1858963 unspecified role unspecified role bait bait tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false Fig1,Fig2, Fig4 gar1p_snr30-1 1858961 N/A 1858964 unspecified role unspecified role bait bait tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 1858962 unspecified role unspecified role prey prey label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro physical association physical association false false false Fig1, Fig2, Fig4 the reaction was performed at various concentration of KCl and it occurs in the presence of 10 to 100 mM KCl snr10 yeast_1-gar1-30 1858961 N/A 1858964 competitor competitor competitor neutral component neutral component in vitro In vitro An excess 20X of snr30 abolishes the interaction N/A 1858962 unspecified role unspecified role prey prey label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 1858963 unspecified role unspecified role bait bait tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro association association false false false Fig3 snr30_yeast_rna-gar1-10 1858961 N/A 1858963 competitor competitor competitor neutral component neutral component in vitro In vitro an excess of 20x of snr10 abolishes the binding N/A 1858962 unspecified role unspecified role prey prey label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 1858964 unspecified role unspecified role bait bait tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro association association false false false Fig3 the reaction was performed at various concentration of KCl and it occurs in the presence of 10 to 100 mM KCl