IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ ubeda-1996-2 Stress-induced binding of the transcriptional factor CHOP to a novel DNA control element. in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Ubeda M., Wang X.Z., Zinszner H., Wu I., Habener J.F., Ron D. rond01@saturn.med.nyu.edu Mol. Cell. Biol. (0270-7306) 1996 Only protein-protein interactions imex curation ubeda-1996-1 Stress-induced binding of the transcriptional factor CHOP to a novel DNA control element. rat-liver rattus norvegicus liver Rat liver liver far western blotting far western blotting Affinity blotting Affinity blotting weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Ubeda M., Wang X.Z., Zinszner H., Wu I., Habener J.F., Ron D. rond01@saturn.med.nyu.edu Mol. Cell. Biol. (0270-7306) 1996 Only protein-protein interactions imex curation ubeda-1996-3 Stress-induced binding of the transcriptional factor CHOP to a novel DNA control element. in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Ubeda M., Wang X.Z., Zinszner H., Wu I., Habener J.F., Ron D. rond01@saturn.med.nyu.edu Mol. Cell. Biol. (0270-7306) 1996 Only protein-protein interactions imex curation ubeda-1996-4 Stress-induced binding of the transcriptional factor CHOP to a novel DNA control element. mouse-3t3 Mus musculus embryo cells 3t3 Mouse embryo fibroblast cells emsa supershift electrophoretic mobility supershift assay emsa supershift weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Ubeda M., Wang X.Z., Zinszner H., Wu I., Habener J.F., Ron D. rond01@saturn.med.nyu.edu Mol. Cell. Biol. (0270-7306) 1996 Only protein-protein interactions imex curation cebpa_rat CCAAT/enhancer-binding protein alpha Cebpa protein protein rat Rattus norvegicus (Rat) Rat MESADFYEAEPRPPMSSHLQSPPHAPSNAAFGFPRGAGPAPPPAPPAAPEPLGGICEHETSIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAAGPAGGGGDFDYPGAPAGPGGAVMSAGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQPPPPPPPPHPHASPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPAMGAAGLPGPGGSLKGLAGPHPDLRTGGGGGGGAGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA ddit3_rat DNA damage-inducible transcript 3 protein Ddit3 Chop Chop10 Gadd153 C/EBP zeta C/EBP-homologous protein C/EBP-homologous protein 10 CCAAT/enhancer-binding protein homologous protein Growth arrest and DNA-damage-inducible protein GADD153 protein protein rat Rattus norvegicus (Rat) Rat MAAESLPFAFETVSSWELEAWYEDLQEVLSSDEIGGTYISSPGNEEEESKTFTTLDPASLAWLTEEPGPAEVTSTSQSPRSPDSSQSSMAQEEEEEDQGRTRKRKQSGQCAARAGKQRMKEKEQENERKVAQLAEENERLKLEIERLTREVETTRRALIDRMVSLHQA cebpb_human CCAAT/enhancer-binding protein beta CEBPB TCF5 PP9092 Liver activator protein Nuclear factor NF-IL6 Transcription factor 5 Liver-enriched inhibitory protein protein protein human Homo sapiens Human MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC cebpb_rat CCAAT/enhancer-binding protein beta Cebpb Crp2 Sfb C/EBP-related protein 2 Interleukin-6-dependent-binding protein Liver-enriched transcriptional activator Silencer factor B Nf-il6 Liver-enriched inhibitory protein protein protein rat Rattus norvegicus (Rat) Rat MHRLLAWDAACLPPPPAAFRPMEVANFYYEPDCLAYGAKAARAAPRAPAAEPAIGEHERAIDFSPYLEPLAPAAADFAAPAPAHHDFLSDLFADDYGAKPSKKPSDYGYVSLGRAGAKAAPPACFPPPPPAALKAEPGFEPADCKRADDAPAMAAGFPFALRAYLGYQATPSGSSGSLSTSSSSSPPGTPSPADAKAAPAACFAGPPAAPAKAKAKKAVDKLSDEYKMRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASAGHC camre calmodulin-responsive element ds dna double stranded deoxyribonucleic acid ds DNA ds dna chemical synthesis Chemical synthesis (Chemical synthesis) AAATGTAGTCTTATGCAATACACTTGTAGTCTTGCAACA ddit3_mouse DNA damage-inducible transcript 3 protein Ddit3 Chop Chop10 Gadd153 C/EBP zeta C/EBP-homologous protein C/EBP-homologous protein 10 CCAAT/enhancer-binding protein homologous protein Growth arrest and DNA-damage-inducible protein GADD153 protein protein mouse Mus musculus Mouse MAAESLPFTLETVSSWELEAWYEDLQEVLSSDEIGGTYISSPGNEEEESKTFTTLDPASLAWLTEEPGPTEVTRTSQSPRSPDSSQSSMAQEEEEEEQGRTRKRKQSGQCPARPGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVETTRRALIDRMVSLHQA ddit3-cebpa-1 1779384 n/a 1779388 unspecified role unspecified role prey prey gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false 304-358 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1779389 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false 32p tag 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig. 2a (blot 2) ddit3-cebpb-1 1779384 n/a 1779389 unspecified role unspecified role bait bait 32p tag 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain false gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1779390 unspecified role unspecified role prey prey gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false 294-345 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false Fig. 2a (blot 1) cebpb-ddit3-1 1779385 n/a 1779391 unspecified role unspecified role prey prey n/a 1779389 unspecified role unspecified role prey prey n/a 1779391 unspecified role unspecified role bait bait bzip_domain sufficient to bind sufficient binding region sufficient to bind range range range range false 32p tag on ser12 of a-kinase box tag 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false a-kinase box tag (merreilsrrpsyrkd) tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 1a (lane 2) camre-cebpb-2 1779386 n/a 1779390 unspecified role unspecified role prey prey bzip domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1779392 unspecified role unspecified role bait bait 32p label 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1779389 unspecified role unspecified role prey prey gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 6a camre-cebpb-3 1779387 n/a 1779392 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1779393 unspecified role unspecified role prey prey physical association physical association false false false Fig. 6c (lane 3) Supershifted with monoclonal antibody 3H8 against CHOP (ddit3).