MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint mork_jansson-2015-1 yeast Saccharomyces cerevisiae Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction predetermined predetermined participant predetermined Mork-Jansson AE., Gargano D., Kmiec K., Furnes C., Shevela D., Eichacker LA. lutz.eichacker@uis.no FEBS letters 2015 Only protein-protein interactions imex curation imex curation mork_jansson-2015-2 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Mork-Jansson AE., Gargano D., Kmiec K., Furnes C., Shevela D., Eichacker LA. lutz.eichacker@uis.no FEBS letters 2015 Only protein-protein interactions imex curation imex curation mork_jansson-2015-3 in vitro In vitro mst microscale thermophoresis mst tag fluorescence tag visualisation by fluorescence tag fluorescence Mork-Jansson AE., Gargano D., Kmiec K., Furnes C., Shevela D., Eichacker LA. lutz.eichacker@uis.no FEBS letters 2015 Only protein-protein interactions imex curation imex curation lil32_arath Light-harvesting complex-like protein 3 isotype 2, chloroplastic LIL3.2 LHC-like protein 3 isoform 2 K14A3.6 At5g47110 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSISMALFSPPISSSLQNPNLIPKISTSLLSTKRFSLISVPRASSDNGTTSPVVEIPKPASVAVEEVPVKSPAESSSASENGAVGGEATDSSTETVIKYQNAKWVNGTWDLKQFEKDGKTDWDSVIVSEAKRRKWLEDNPETTSNDELVVFDTSIIPWWAWMKRYHLPEAELLNGRAAMIGFFMAYFVDSLTGVGLVDQMGNFFCKTLLFVAVAGVLFIRKNEDLDKLKDLFDETTLYDKQWQAAWKEPDSSTVSSKK lil31_arath Light-harvesting complex-like protein 3 isotype 1, chloroplastic LIL3.1 LHC-like protein 3 isoform 1 dl4835w At4g17600 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MALFSPPISSSSLQNPNFIPKFSFSLLSSNRFSLLSVTRASSDSGSTSPTAAVSVEAPEPVEVIVKEPPQSTPAVKKEETATAKNVAVEGEEMKTTESVVKFQDARWINGTWDLKQFEKDGKTDWDSVIVAEAKRRKWLEENPETTSNDEPVLFDTSIIPWWAWIKRYHLPEAELLNGRAAMIGFFMAYFVDSLTGVGLVDQMGNFFCKTLLFVAVAGVLFIRKNEDVDKLKNLFDETTLYDKQWQAAWKNDDDESLGSKKK lil3:1-q9ltb7_arath-1 1884231 N/A 1884234 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1884235 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f1 lil3:1-lil3:1-1 1884231 N/A 1884235 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1884235 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f1 q9ltb7_arath-q9ltb7_arath-1 1884231 N/A 1884234 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1884234 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f1 1-79 1884232 N/A 1884235 unspecified role unspecified role prey prey purified purified N/A 1884235 unspecified role unspecified role bait bait purified purified direct interaction direct interaction false false false 1884232 f2a lil3:1-lil3:1-2 1884232 N/A 1884234 unspecified role unspecified role prey prey purified purified N/A 1884234 unspecified role unspecified role bait bait purified purified direct interaction direct interaction false false false 1884232 f2b lil3:1-q9ltb7_arath-2 1884232 N/A 1884234 unspecified role unspecified role prey prey purified purified N/A 1884235 unspecified role unspecified role bait bait purified purified direct interaction direct interaction false false false 1884232 f2c 1-80 1884233 N/A 1884235 unspecified role unspecified role neutral component neutral component purified purified fluorophore fluorophore fluorophore undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1884234 unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false 1884233 f3a lil3:1-q9ltb7_arath-3 1884233 N/A 1884234 unspecified role unspecified role neutral component neutral component purified purified fluorophore fluorophore fluorophore undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1884234 unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false 1884233 f3b